Publication Information

{'id': 'https://openalex.org/W2089191180', 'doi': 'https://doi.org/10.1074/jbc.272.48.30380', 'title': 'Identification of a Ganglioside Recognition Domain of Tetanus Toxin Using a Novel Ganglioside Photoaffinity Ligand', 'display_name': 'Identification of a Ganglioside Recognition Domain of Tetanus Toxin Using a Novel Ganglioside Photoaffinity Ligand', 'publication_year': 1997, 'publication_date': '1997-11-01', 'ids': {'openalex': 'https://openalex.org/W2089191180', 'doi': 'https://doi.org/10.1074/jbc.272.48.30380', 'mag': '2089191180', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/9374528'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.272.48.30380', 'pdf_url': 'http://www.jbc.org/article/S0021925819897302/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925819897302/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5018717855', 'display_name': 'Robert Shapiro', 'orcid': 'https://orcid.org/0000-0003-3378-3585'}, 'institutions': [{'id': 'https://openalex.org/I145311948', 'display_name': 'Johns Hopkins University', 'ror': 'https://ror.org/00za53h95', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I145311948']}, {'id': 'https://openalex.org/I2799853436', 'display_name': 'Johns Hopkins Medicine', 'ror': 'https://ror.org/037zgn354', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2799853436']}], 'countries': ['US'], 'is_corresponding': True, 'raw_author_name': 'Robert E. Shapiro', 'raw_affiliation_strings': ['Department of Neurology, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205'], 'affiliations': [{'raw_affiliation_string': 'Department of Neurology, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I145311948', 'https://openalex.org/I2799853436']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5048444388', 'display_name': 'Chelsea D. Specht', 'orcid': 'https://orcid.org/0000-0001-7746-512X'}, 'institutions': [{'id': 'https://openalex.org/I2799853436', 'display_name': 'Johns Hopkins Medicine', 'ror': 'https://ror.org/037zgn354', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2799853436']}, {'id': 'https://openalex.org/I145311948', 'display_name': 'Johns Hopkins University', 'ror': 'https://ror.org/00za53h95', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I145311948']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Chelsea D. Specht', 'raw_affiliation_strings': ['Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205'], 'affiliations': [{'raw_affiliation_string': 'Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I2799853436', 'https://openalex.org/I145311948']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5028969843', 'display_name': 'Brian E. Collins', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I2799853436', 'display_name': 'Johns Hopkins Medicine', 'ror': 'https://ror.org/037zgn354', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2799853436']}, {'id': 'https://openalex.org/I145311948', 'display_name': 'Johns Hopkins University', 'ror': 'https://ror.org/00za53h95', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I145311948']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Brian E. Collins', 'raw_affiliation_strings': ['Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205'], 'affiliations': [{'raw_affiliation_string': 'Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I2799853436', 'https://openalex.org/I145311948']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5069741153', 'display_name': 'Amina S. Woods', 'orcid': 'https://orcid.org/0000-0002-9716-345X'}, 'institutions': [{'id': 'https://openalex.org/I2799853436', 'display_name': 'Johns Hopkins Medicine', 'ror': 'https://ror.org/037zgn354', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2799853436']}, {'id': 'https://openalex.org/I145311948', 'display_name': 'Johns Hopkins University', 'ror': 'https://ror.org/00za53h95', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I145311948']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Amina S. Woods', 'raw_affiliation_strings': ['Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205'], 'affiliations': [{'raw_affiliation_string': 'Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I2799853436', 'https://openalex.org/I145311948']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5079988714', 'display_name': 'Robert J. Cotter', 'orcid': 'https://orcid.org/0000-0002-7535-6576'}, 'institutions': [{'id': 'https://openalex.org/I2799853436', 'display_name': 'Johns Hopkins Medicine', 'ror': 'https://ror.org/037zgn354', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2799853436']}, {'id': 'https://openalex.org/I145311948', 'display_name': 'Johns Hopkins University', 'ror': 'https://ror.org/00za53h95', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I145311948']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Robert J. Cotter', 'raw_affiliation_strings': ['Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205'], 'affiliations': [{'raw_affiliation_string': 'Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I2799853436', 'https://openalex.org/I145311948']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5068104814', 'display_name': 'Ronald L. Schnaar', 'orcid': 'https://orcid.org/0000-0002-7701-5484'}, 'institutions': [{'id': 'https://openalex.org/I2799853436', 'display_name': 'Johns Hopkins Medicine', 'ror': 'https://ror.org/037zgn354', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2799853436']}, {'id': 'https://openalex.org/I145311948', 'display_name': 'Johns Hopkins University', 'ror': 'https://ror.org/00za53h95', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I145311948']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Ronald L. Schnaar', 'raw_affiliation_strings': ['Department of Neuroscience, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205'], 'affiliations': [{'raw_affiliation_string': 'Department of Neuroscience, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I2799853436', 'https://openalex.org/I145311948']}, {'raw_affiliation_string': 'Departments of Pharmacology and Molecular Sciences, The Johns Hopkins University School of Medicine, Baltimore, Maryland 21205', 'institution_ids': ['https://openalex.org/I2799853436', 'https://openalex.org/I145311948']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 2, 'corresponding_author_ids': ['https://openalex.org/A5018717855'], 'corresponding_institution_ids': ['https://openalex.org/I145311948', 'https://openalex.org/I2799853436'], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 2.508, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 94, 'citation_normalized_percentile': {'value': 0.913266, 'is_in_top_1_percent': False, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 95, 'max': 96}, 'biblio': {'volume': '272', 'issue': '48', 'first_page': '30380', 'last_page': '30386'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T10602', 'display_name': 'Glycosylation and Glycoproteins Research', 'score': 0.9987, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T10602', 'display_name': 'Glycosylation and Glycoproteins Research', 'score': 0.9987, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11016', 'display_name': 'Monoclonal and Polyclonal Antibodies Research', 'score': 0.9864, 'subfield': {'id': 'https://openalex.org/subfields/2741', 'display_name': 'Radiology, Nuclear Medicine and Imaging'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, {'id': 'https://openalex.org/T12477', 'display_name': 'Toxin Mechanisms and Immunotoxins', 'score': 0.9835, 'subfield': {'id': 'https://openalex.org/subfields/2403', 'display_name': 'Immunology'}, 'field': {'id': 'https://openalex.org/fields/24', 'display_name': 'Immunology and Microbiology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/ganglioside', 'display_name': 'Ganglioside', 'score': 0.8500414}, {'id': 'https://openalex.org/keywords/identification', 'display_name': 'Identification', 'score': 0.5787153}], 'concepts': [{'id': 'https://openalex.org/C2777331542', 'wikidata': 'https://www.wikidata.org/wiki/Q419287', 'display_name': 'Ganglioside', 'level': 2, 'score': 0.8500414}, {'id': 'https://openalex.org/C116834253', 'wikidata': 'https://www.wikidata.org/wiki/Q2039217', 'display_name': 'Identification (biology)', 'level': 2, 'score': 0.5787153}, {'id': 'https://openalex.org/C2777367657', 'wikidata': 'https://www.wikidata.org/wiki/Q184651', 'display_name': 'Toxin', 'level': 2, 'score': 0.57288754}, {'id': 'https://openalex.org/C2779841045', 'wikidata': 'https://www.wikidata.org/wiki/Q47790', 'display_name': 'Tetanus', 'level': 3, 'score': 0.52548176}, {'id': 'https://openalex.org/C116569031', 'wikidata': 'https://www.wikidata.org/wiki/Q899107', 'display_name': 'Ligand (biochemistry)', 'level': 3, 'score': 0.50987875}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.42186952}, {'id': 'https://openalex.org/C36503486', 'wikidata': 'https://www.wikidata.org/wiki/Q11235244', 'display_name': 'Domain (mathematical analysis)', 'level': 2, 'score': 0.42030817}, {'id': 'https://openalex.org/C70721500', 'wikidata': 'https://www.wikidata.org/wiki/Q177005', 'display_name': 'Computational biology', 'level': 1, 'score': 0.35722783}, {'id': 'https://openalex.org/C71924100', 'wikidata': 'https://www.wikidata.org/wiki/Q11190', 'display_name': 'Medicine', 'level': 0, 'score': 0.33475614}, {'id': 'https://openalex.org/C170493617', 'wikidata': 'https://www.wikidata.org/wiki/Q208467', 'display_name': 'Receptor', 'level': 2, 'score': 0.26561028}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.25996345}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.21281743}, {'id': 'https://openalex.org/C203014093', 'wikidata': 'https://www.wikidata.org/wiki/Q101929', 'display_name': 'Immunology', 'level': 1, 'score': 0.16685852}, {'id': 'https://openalex.org/C33923547', 'wikidata': 'https://www.wikidata.org/wiki/Q395', 'display_name': 'Mathematics', 'level': 0, 'score': 0.08028713}, {'id': 'https://openalex.org/C59822182', 'wikidata': 'https://www.wikidata.org/wiki/Q441', 'display_name': 'Botany', 'level': 1, 'score': 0.0}, {'id': 'https://openalex.org/C22070199', 'wikidata': 'https://www.wikidata.org/wiki/Q192995', 'display_name': 'Vaccination', 'level': 2, 'score': 0.0}, {'id': 'https://openalex.org/C134306372', 'wikidata': 'https://www.wikidata.org/wiki/Q7754', 'display_name': 'Mathematical analysis', 'level': 1, 'score': 0.0}], 'mesh': [{'descriptor_ui': 'D005732', 'descriptor_name': 'Gangliosides', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': True}, {'descriptor_ui': 'D013744', 'descriptor_name': 'Tetanus Toxin', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D000345', 'descriptor_name': 'Affinity Labels', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D001386', 'descriptor_name': 'Azides', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D001665', 'descriptor_name': 'Binding Sites', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D005732', 'descriptor_name': 'Gangliosides', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008024', 'descriptor_name': 'Ligands', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013058', 'descriptor_name': 'Mass Spectrometry', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D010777', 'descriptor_name': 'Photochemistry', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D016415', 'descriptor_name': 'Sequence Alignment', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D017386', 'descriptor_name': 'Sequence Homology, Amino Acid', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013744', 'descriptor_name': 'Tetanus Toxin', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.272.48.30380', 'pdf_url': 'http://www.jbc.org/article/S0021925819897302/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/9374528', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.272.48.30380', 'pdf_url': 'http://www.jbc.org/article/S0021925819897302/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 34, 'referenced_works': ['https://openalex.org/W1489073014', 'https://openalex.org/W1512697776', 'https://openalex.org/W1562285763', 'https://openalex.org/W1629424370', 'https://openalex.org/W1866614653', 'https://openalex.org/W1964527029', 'https://openalex.org/W1975085160', 'https://openalex.org/W1984315150', 'https://openalex.org/W1991882360', 'https://openalex.org/W1996105722', 'https://openalex.org/W2023474271', 'https://openalex.org/W2041201209', 'https://openalex.org/W2068001157', 'https://openalex.org/W2072728780', 'https://openalex.org/W2072946260', 'https://openalex.org/W2076140025', 'https://openalex.org/W2080072338', 'https://openalex.org/W2084440722', 'https://openalex.org/W2086151911', 'https://openalex.org/W2087719340', 'https://openalex.org/W2094886338', 'https://openalex.org/W2101367047', 'https://openalex.org/W2127596981', 'https://openalex.org/W2137296795', 'https://openalex.org/W2155019524', 'https://openalex.org/W2161097693', 'https://openalex.org/W2170306518', 'https://openalex.org/W2215442559', 'https://openalex.org/W2238363303', 'https://openalex.org/W241110173', 'https://openalex.org/W4232300002', 'https://openalex.org/W4246786135', 'https://openalex.org/W618766976', 'https://openalex.org/W959574011'], 'related_works': ['https://openalex.org/W86077716', 'https://openalex.org/W2438422034', 'https://openalex.org/W2423854683', 'https://openalex.org/W2419480887', 'https://openalex.org/W2414579877', 'https://openalex.org/W2409602088', 'https://openalex.org/W2381538932', 'https://openalex.org/W2328094839', 'https://openalex.org/W2038198109', 'https://openalex.org/W1605877026'], 'abstract_inverted_index': {'Tetanus': [0, 193], 'toxin': [1, 29, 80, 106, 140, 187, 194, 222, 273, 299, 333, 380, 549, 598, 603, 715, 756, 828, 1081, 1100, 1180, 1243, 1275, 1313, 1335, 1360, 1390, 1415, 1430, 1449, 1456, 1481, 1492, 1552, 1589, 1639, 1665, 1709, 1726, 1786, 1811, 1824, 1858, 1889, 1951, 1971, 1981, 2001, 2025, 2075, 2086, 2096, 2171, 2211, 2221, 2266, 2290, 2350, 2393, 2768, 2784, 2915, 2944, 3033, 3037, 3131, 3368, 3418, 3659, 3695, 3811, 3854], 'entry': [2, 195, 463], 'into': [3, 196], 'vertebrate': [4, 197, 404, 3819, 3847], 'motorneurons': [5, 198, 405], 'may': [6, 199, 819, 1066, 1294, 1385, 1804, 3208, 3286, 3379, 3633, 3687, 3741, 3813, 3842], 'involve': [7, 200], 'binding': [8, 33, 201, 226, 468, 604, 1035, 1161, 1247, 1265, 1287, 1316, 1384, 1771, 3049, 3127, 3148, 3186, 3255, 3303, 3332, 3375, 3401, 3696, 3737, 3750, 3852, 3865], 'of': [9, 27, 42, 59, 69, 78, 91, 137, 154, 162, 185, 202, 220, 235, 252, 262, 271, 284, 330, 347, 355, 378, 397, 413, 447, 466, 481, 486, 505, 534, 753, 844, 1033, 1171, 1178, 1200, 1241, 1272, 1280, 1290, 1311, 1326, 1377, 1413, 1428, 1440, 1479, 1490, 1501, 1565, 1600, 1616, 1635, 1661, 1724, 1747, 1781, 1784, 1801, 1809, 1836, 1845, 1881, 1887, 1934, 1969, 2015, 2072, 2083, 2134, 2151, 2158, 2209, 2219, 2243, 2250, 2254, 2259, 2264, 2282, 2302, 2347, 2391, 2409, 2424, 2431, 2465, 2471, 2478, 2508, 2519, 2540, 2553, 2565, 2628, 2648, 2673, 2701, 2703, 2714, 2754, 2765, 2771, 2782, 2927, 2942, 2984, 2996, 3031, 3050, 3101, 3128, 3149, 3175, 3361, 3366, 3370, 3393, 3404, 3408, 3596, 3629, 3675, 3707, 3744, 3775, 3796, 3830, 3846, 3867, 3891], 'neuronal': [10, 203], 'surface': [11, 204, 509], 'gangliosides': [12, 205, 580, 1739, 3137, 3188, 3220], 'containing': [13, 206, 539, 581, 1916, 1944, 2120, 2131, 2167], 'the': [14, 39, 43, 57, 60, 66, 92, 148, 169, 207, 232, 236, 250, 253, 259, 285, 341, 362, 482, 582, 710, 754, 827, 850, 1031, 1165, 1172, 1184, 1238, 1269, 1273, 1342, 1349, 1352, 1368, 1393, 1405, 1410, 1447, 1578, 1598, 1637, 1676, 1689, 1752, 1763, 1775, 1802, 1834, 1843, 1914, 1920, 1928, 1950, 2011, 2016, 2038, 2051, 2105, 2112, 2129, 2132, 2149, 2152, 2165, 2196, 2200, 2206, 2215, 2238, 2251, 2260, 2272, 2277, 2343, 2404, 2410, 2457, 2463, 2472, 2509, 2514, 2529, 2541, 2566, 2573, 2581, 2592, 2629, 2649, 2653, 2704, 2715, 2738, 2751, 2766, 2793, 2886, 2954, 2985, 2997, 3026, 3060, 3099, 3126, 3173, 3298, 3307, 3387, 3405, 3409, 3627, 3644, 3689, 3705, 3747, 3776, 3808, 3831, 3863], '"1b"': [15, 208, 583], 'substructure': [16, 209, 584], '(a': [17, 210, 585], 'NeuAcα2,8NeuAc': [18, 211, 586], 'group': [19, 212, 587, 2444, 2599, 2668, 2817], 'on': [20, 213, 470, 588, 1508, 2037, 2104, 2338, 2652, 2792, 2885, 2953, 3769], 'an': [21, 214, 430, 589, 1670, 1932, 2638, 3248, 3381], 'internal': [22, 215, 590], 'galactose': [23, 216, 591], 'residue).': [24, 217], 'The': [25, 218, 386, 488, 841, 1357, 1741, 1866, 1878, 1902, 2118, 2178, 2257, 2563, 2607, 2776, 2936, 3319, 3673], 'domains': [26, 68, 219, 261, 1310, 1800], 'tetanus': [28, 70, 79, 105, 139, 155, 186, 221, 263, 272, 298, 332, 348, 379, 392, 548, 714, 1179, 1242, 1274, 1312, 1334, 1359, 1414, 1429, 1448, 1455, 1480, 1491, 1588, 1638, 1664, 1708, 1725, 1785, 1810, 1823, 1857, 1888, 1970, 1980, 2000, 2024, 2074, 2085, 2095, 2122, 2136, 2170, 2210, 2220, 2244, 2265, 2283, 2349, 2392, 2520, 2767, 2783, 2914, 2943, 3032, 3062, 3130, 3257, 3367, 3417, 3658, 3694, 3869], 'involved': [30, 223, 1314], 'in': [31, 224, 550, 825, 1209, 1315, 1338, 1396, 1520, 1669, 1694, 1703, 1706, 1729, 1833, 1842, 1893, 1941, 1948, 2010, 2062, 2101, 2116, 2228, 2296, 2429, 2462, 2483, 2602, 2612, 2622, 2724, 2820, 2921, 3065, 3250, 3306, 3334, 3593, 3660, 3785, 3818, 3839, 3844], 'ganglioside': [32, 62, 90, 102, 191, 225, 255, 283, 295, 384, 814, 839, 1034, 1160, 1251, 1264, 1328, 1383, 1419, 1462, 1496, 1517, 1770, 1806, 1837, 2018, 2310, 3067, 3169, 3292, 3302, 3374, 3400, 3837, 3864], 'are': [34, 227, 394, 458, 2292, 3006, 3045, 3203, 3304, 3395, 3414, 3654, 3668, 3779], 'known': [35, 228, 3396], 'to': [36, 64, 229, 257, 460, 484, 595, 601, 605, 673, 692, 1248, 1286, 1307, 1317, 1389, 1465, 1498, 1581, 1687, 1768, 1875, 2045, 2140, 2142, 2176, 2195, 2205, 2300, 2306, 2342, 2504, 2513, 2591, 2677, 2732, 2742, 2763, 2809, 2913, 2969, 2977, 3011, 3047, 3059, 3079, 3086, 3133, 3136, 3153, 3164, 3187, 3212, 3219, 3235, 3397, 3416, 3601, 3697], 'reside': [37, 230], 'within': [38, 231, 3284], 'carboxyl-terminal': [40, 149, 233, 342, 1167, 1270, 1982, 2052, 2239, 2278, 2389, 2515, 2780, 2940, 2974, 3027, 3308, 3336, 3406, 3662, 3771], 'half': [41, 234, 1168], "toxin's": [44, 237, 1353], 'heavy': [45, 238, 1174], 'chain': [46, 239], '("C': [47, 240], 'fragment").': [48, 241], 'We': [49, 180, 242, 373], 'developed': [50, 243, 1301], 'a': [51, 89, 99, 119, 163, 176, 244, 282, 292, 312, 356, 369, 395, 425, 503, 531, 1061, 1068, 1210, 1302, 1441, 1499, 1653, 1721, 1730, 1744, 1882, 2063, 2067, 2143, 2156, 2181, 2229, 2432, 2441, 2585, 2596, 2616, 2664, 2814, 2922, 3228, 3244, 3362, 3701], 'novel': [52, 245, 1303], 'photoaffinity': [53, 164, 246, 357, 1305, 1379, 1424, 1608, 1681, 1830, 1967, 2007, 2524, 2630, 2773, 2838, 2866, 2933, 2982, 3080, 3312, 3676], 'reagent': [54, 247], 'based': [55, 248, 2337], 'upon': [56, 249, 2148], 'structure': [58, 251, 1285], '1b': [61, 93, 254, 286, 1318, 1737, 3051], 'GD1b(125I-azido-GD1b)': [63, 256], 'define': [65, 258, 1067], 'ganglioside-binding': [67, 260, 1355], 'toxin.': [71, 156, 264, 349], 'Using': [72, 265, 1400], 'this': [73, 183, 266, 376, 1298, 1401, 1685, 2719, 3055], 'ligand,': [74, 267], 'we': [75, 268, 1300, 1403], 'observed': [76, 123, 269, 316, 1750], 'radiolabeling': [77, 270, 1439, 1469, 1510, 1628], 'C': [81, 107, 141, 274, 300, 334, 1276, 1336, 1361, 1431, 1450, 1457, 1482, 1493, 1553, 1590, 1640, 1666, 1710, 1787, 1812, 1825, 1859, 1890, 1972, 2002, 2026, 2076, 2087, 2097, 2172, 2222, 2267, 3034, 3063, 3651, 3855], 'fragment': [82, 108, 142, 275, 301, 335, 1337, 1362, 1432, 1451, 1458, 1483, 1494, 1554, 1591, 1641, 1655, 1667, 1711, 1723, 1788, 1813, 1826, 1860, 1891, 1905, 1930, 1952, 1973, 2003, 2027, 2077, 2088, 2173, 2223, 2268, 2717, 2740, 3035, 3064], 'which': [83, 129, 276, 322, 1444, 1627, 1678, 1707, 1923, 1949, 2224, 2269, 2500, 3394, 3413, 3632, 3641, 3667, 3686], 'could': [84, 277, 546], 'be': [85, 278, 1295, 1386, 1688, 2307, 3287, 3380, 3602], 'specifically': [86, 279, 3092], 'inhibited': [87, 132, 280, 325, 1471, 1631, 3253, 3670], 'by': [88, 98, 124, 133, 281, 291, 317, 326, 464, 475, 1164, 1268, 1435, 1632, 1657, 1736, 1870, 2126, 2309, 2398, 2842, 2872, 3094, 3604, 3671, 3825], 'series': [94, 101, 287, 294, 1319, 1738, 3052], '(GT1b),': [95, 288], 'but': [96, 289, 3171, 3871], 'not': [97, 290, 498, 1528, 1715, 1896, 1956, 2468, 2481, 2498, 2502, 2633, 3157, 3209, 3861], 'non-1b': [100, 293], '(GM3).': [103, 296], 'When': [104, 297, 1454], 'was': [109, 122, 130, 302, 315, 323, 1330, 1344, 1363, 1459, 1470, 1504, 1557, 1592, 1629, 1642, 1679, 1712, 1749, 1755, 1829, 1861, 1906, 1953, 2006, 2028, 2058, 2078, 2114, 2124, 2138, 2162, 2394, 2454, 2460, 2600, 2746, 2757, 2790, 2883, 2951, 3071, 3076, 3091], 'proteolyzed': [110, 138, 303, 331, 1366, 1574, 1594, 1643, 1663, 2168, 2772, 2932], 'with': [111, 144, 304, 337, 400, 816, 1030, 1333, 1446, 1461, 1467, 1495, 1516, 1531, 1562, 1571, 1575, 1595, 1603, 1652, 1864, 1900, 1936, 1979, 2031, 2050, 2183, 2234, 2271, 2418, 2437, 2440, 2474, 2543, 2572, 2595, 2659, 2663, 2786, 2795, 2813, 2946, 2957, 2962, 3098, 3646, 3665, 3849, 3888], 'clostripain,': [112, 305, 1576, 1596], 'whether': [113, 306, 1636, 1751], 'before': [114, 307, 1644, 1757, 1814, 1974], 'or': [115, 308, 1561, 1568, 1645, 1758, 1815, 1820, 1841, 1851, 1998, 2013, 2420, 2803, 2865, 3135, 3761, 3787], 'after': [116, 309, 1619, 1646, 1759, 1816, 1976], 'reaction': [117, 310, 1343, 1466, 1647, 1754, 1792], 'with125I-azido-GD1b,': [118, 311, 1433], 'radiolabeled': [120, 313, 1370, 1691, 1697, 1921, 2121, 2154], 'band': [121, 146, 314, 339, 1443, 1625, 1650, 1922], 'SDS-polyacrylamide': [125, 318], 'gel': [126, 319, 2042, 2113], 'electrophoresis': [127, 320], 'autoradiography,': [128, 321, 2127], 'selectively': [131, 324, 1630, 1734], 'GT1b.': [134, 327, 1488, 3672], 'Protein': [135, 328, 415, 449, 1202, 3798], 'sequencing': [136, 329], 'co-migrating': [143, 336, 1978, 2049], 'that': [145, 182, 338, 375, 530, 1060, 1263, 1382, 1695, 1720, 1732, 1743, 1762, 1777, 1798, 2725, 2750, 3025, 3159, 3172, 3199, 3281, 3297, 3377, 3810], 'revealed': [147, 173, 340, 366, 2403, 2569, 2656], '34': [150, 343, 2240, 2279, 2516, 3028, 3088], 'amino': [151, 344, 845, 1063, 1190, 2197, 2241, 2280, 2344, 2517, 2678, 2705, 2743, 2759, 2916, 3029, 3038, 3089, 3176, 3200, 3282, 3338, 3764, 3832], 'acid': [152, 171, 345, 364, 542, 846, 1064, 1407, 2345, 2388, 2760, 2779, 2939, 3039, 3364, 3691, 3749, 3833], 'residues': [153, 346, 2910, 3040, 3300, 3631, 3683], 'Matrix-assisted': [157, 350], 'laser': [158, 351], 'desorption/ionization': [159, 352], 'mass': [160, 353, 2408, 2844, 2874], 'spectrometry': [161, 354, 2654, 2875], 'labeled': [165, 358, 1609, 1764, 1831, 2008, 2226, 2274, 2505, 2525, 2674, 2774, 2839, 2867, 2934], 'synthetic': [166, 359, 2510, 2777, 2863, 2937, 3083], 'polypeptide': [167, 360, 1292, 1309, 1442, 1654, 1692, 1803, 2091, 2412, 2473, 2511, 2532, 2542, 2568, 2593, 2651, 2781, 2941, 3084], 'representing': [168, 361, 2276], '34-amino': [170, 363, 1406, 2387, 2778, 2938, 3363], 'domain': [172, 184, 365, 377, 2390, 3384], 'modification': [174, 367, 2439], 'at': [175, 368, 1254, 1351, 1409, 1426, 1485, 1523, 2758, 2988, 3001, 3138, 3316, 3738, 3766], 'single': [177, 370, 2442, 2597, 2665, 2815], 'residue': [178, 371, 2987, 3317], '(His1293).': [179, 372], 'propose': [181, 374], 'is': [188, 381, 424, 671, 690, 1162, 1181, 1266, 1381, 1395, 1733, 1766, 1898, 1931, 2225, 2232, 2285, 2336, 2615, 2636, 3057, 3162, 3679], 'sufficient': [189, 382, 833, 1417, 1767, 3046, 3163], 'for': [190, 383, 403, 493, 713, 834, 1074, 1418, 1626, 2294, 2528, 2826, 3125, 3205, 3290, 3301, 3836], 'binding.': [192, 385, 840, 1076, 3181, 3293], 'major': [387, 2752], 'Clostridial': [388, 853, 2255, 3390, 3840], 'neurotoxins,': [389, 3391], 'botulinum': [390, 755, 1099, 2289, 3411, 3649], 'and': [391, 434, 479, 600, 751, 832, 838, 1098, 1137, 1187, 1215, 1244, 1252, 1257, 1283, 1340, 1367, 1373, 1421, 1573, 1577, 1607, 1873, 1909, 1975, 2043, 2092, 2174, 2396, 2448, 2496, 2522, 2535, 2547, 2561, 2580, 2605, 2635, 2692, 2709, 2837, 2893, 2905, 2929, 3004, 3103, 3141, 3168, 3189, 3227, 3256, 3311, 3652, 3757, 3822, 3882], 'toxins,': [393], 'family': [396], 'homologous': [398, 2288, 3389, 3415], 'proteins': [399, 1038, 3848], 'selective': [401, 3874], 'toxicity': [402, 3259], '(1Niemann': [406, 440, 1193, 3789], 'H.': [407, 441, 872, 886, 894, 961, 977, 1194, 2368, 3265, 3271, 3436, 3450, 3458, 3525, 3541, 3790, 3913], 'Alouf': [408, 442, 1195, 3791], 'J.E.': [409, 443, 1196, 3792], 'Freer': [410, 444, 1197, 3793], 'J.': [411, 445, 612, 636, 649, 657, 720, 733, 741, 798, 864, 874, 890, 895, 1000, 1088, 1109, 1126, 1198, 1221, 1540, 2360, 2370, 3109, 3348, 3428, 3438, 3454, 3459, 3564, 3724, 3794, 3900, 3942], 'Sourcebook': [412, 446, 1199, 3795], 'Bacterial': [414, 448, 1201, 3797], 'Toxins.': [416, 450, 1203, 3799], 'Academic': [417, 451, 1204, 3800], 'Press,': [418, 452, 1205, 3801], 'London1991:': [419, 453, 1206, 3802], '303-348Google': [420, 454, 1207, 3803], 'Scholar).': [421, 526, 577, 666, 687, 2331, 3735, 3804], 'Their': [422, 1260], 'neurotropism': [423], 'long': [426], 'studied': [427], 'phenomenon': [428], '(for': [429], 'excellent': [431], 'historical': [432, 436], 'review': [433], 'primary': [435], 'references,': [437], 'see': [438, 3042], 'Niemann': [439, 871, 893, 976, 2367, 3270, 3435, 3457, 3540], 'Scholar)).': [455], 'These': [456, 1717], 'toxins': [457, 483, 496, 854, 1079, 3412, 3640, 3753, 3778, 3841], 'believed': [459], 'gain': [461], 'neural': [462, 3698], 'recognition': [465, 1071, 3383, 3636, 3838], 'specific': [467, 1423, 3373], 'sites': [469, 485, 513], 'motorneuronal': [471, 3878], 'axonal': [472, 3880], 'processes,': [473], 'followed': [474, 1434, 1793], 'endocytosis,': [476], 'intracellular': [477], 'transport,': [478], 'targeting': [480], 'action.': [487], 'motorneuron': [489], 'membrane': [490, 837, 2161], 'structures': [491, 3772], 'responsible': [492, 1073], 'reception': [494], 'ofClostridial': [495], 'have': [497, 3759, 3814], 'been': [499, 823, 3816], 'definitively': [500], 'established.': [501], 'However,': [502], 'wealth': [504], 'data': [506, 1261, 1714, 2497], 'implicate': [507], 'cell': [508, 836, 3331], 'glycolipids': [510], 'as': [511, 1416, 2237, 2557, 2889, 3009], 'toxin-binding': [512], '(2Habermann': [514], 'E.': [515, 627, 870, 2366, 3434, 3715, 3929], 'Dreyer': [516], 'F.': [517], 'Curr.': [518], 'Top.': [519], 'Microbiol.': [520, 786, 921, 1022, 1050, 2323, 3485, 3586, 3617], 'Immunol.': [521], '1986;': [522, 875, 2371, 3439, 3931, 3945], '129:': [523], '93-179PubMed': [524], 'Google': [525, 563, 576, 622, 646, 665, 686, 705, 730, 749, 773, 793, 811, 881, 905, 926, 956, 987, 1007, 1027, 1057, 1096, 1117, 1135, 1158, 1231, 1550, 2330, 2377, 3119, 3278, 3358, 3445, 3469, 3490, 3520, 3551, 3571, 3591, 3624, 3734, 3908, 3922, 3937], 'Early': [527], 'studies': [528, 1535, 3197], 'demonstrated': [529, 709, 1622], 'crude': [532], 'preparation': [533], 'mixed': [535], 'brain': [536, 606], 'gangliosides,': [537, 3213], 'glycosphingolipids': [538], 'anionic': [540], 'sialic': [541, 3690, 3748], '(NeuAc)': [543], 'carbohydrate': [544, 1070, 3635, 3851], 'residues,': [545], '"fix"': [547], 'vitro': [551], '(3van': [552], 'Heyningen': [553], 'S.': [554, 776, 796, 969, 1040, 1120, 1148, 2313, 3533, 3607], 'Pharmacol.': [555, 571], 'Ther.': [556], '1980;': [557, 639, 659, 743, 767, 3727], '11:': [558], '141-157Crossref': [559], 'PubMed': [560, 575, 621, 645, 662, 683, 702, 729, 746, 770, 810, 878, 904, 925, 953, 984, 1093, 1114, 1134, 1155, 1230, 1549, 2374, 3118, 3277, 3357, 3442, 3468, 3489, 3517, 3548, 3733, 3905, 3919, 3934, 3948], 'Scopus': [561, 663, 684, 703, 747, 771, 791, 879, 954, 985, 1005, 1055, 1094, 1115, 1156, 2328, 2375, 3443, 3518, 3549, 3569, 3622, 3906, 3920, 3935, 3949], '(26)': [562], 'Scholar,': [564, 623, 647, 731, 774, 794, 882, 906, 927, 957, 988, 1008, 1118, 3446, 3470, 3491, 3521, 3552, 3572, 3909, 3923, 3938], '4Wellhoner': [565], 'H.H.': [566], 'Rev.': [567], 'Physiol.': [568], 'Biochem.': [569, 658, 742, 946, 1001, 3510, 3565], 'Exp.': [570], '1982;': [572], '93:': [573], '1-68Crossref': [574], 'Subsequently,': [578], 'purified': [579, 1372, 2397], 'residue)': [592], 'were': [593, 1699, 1868, 2035, 2099, 2555, 2734, 2818, 2870, 2979], 'shown': [594], 'directly': [596, 3211], 'support': [597, 3048, 3165], 'binding,': [599, 1420, 3068, 3170, 3206, 3226], 'inhibit': [602], 'membranes': [607, 3699], '(5Rogers': [608, 716, 1536], 'T.B.': [609, 635, 717, 1537, 3723], 'Snyder': [610, 718, 1538], 'S.H.': [611, 719, 1539], 'Biol.': [613, 637, 721, 896, 1222, 1541, 3110, 3349, 3460, 3725], 'Chem.': [614, 638, 722, 897, 1223, 1542, 3111, 3350, 3461, 3726], '1981;': [615, 723, 1543], '256:': [616, 724, 1544], '2402-2407Abstract': [617, 725, 1545], 'Full': [618, 642, 726, 901, 1227, 1546, 3115, 3354, 3465, 3730], 'Text': [619, 643, 727, 902, 1228, 1547, 3116, 3355, 3466, 3731], 'PDF': [620, 644, 728, 903, 1229, 1548, 3117, 3356, 3467, 3732], '6Morris': [624, 3712], 'N.P.': [625, 918, 998, 3482, 3562, 3713], 'Consiglio': [626, 3714], 'Kohn': [628, 3716], 'L.D.': [629, 3717], 'Habig': [630, 3718], 'W.H.': [631, 3719], 'Hardegree': [632, 3720], 'M.C.': [633, 3721], 'Helting': [634, 3722], '255:': [640, 3728], '6071-6076Abstract': [641, 3729], '7Holmgren': [648, 732], 'Elwing': [650, 734], 'P.': [651, 653, 735, 737, 2908], 'Fredman': [652, 736], 'Svennerholm': [654, 674, 693, 738], 'L.': [655, 676, 695, 739], 'Eur.': [656, 740, 999, 3563], '106:': [660, 744], '371-379Crossref': [661, 745], '(110)': [664, 748], 'Ganglioside': [667], 'GT1b': [668, 1250, 1463, 1567, 1848, 1917, 2311, 3605, 3647], '1Ganglioside': [669, 688], 'nomenclature': [670, 689], 'according': [672, 691], '(35Svennerholm': [675, 694], 'Prog.': [677, 696], 'Brain': [678, 697, 3914, 3943], 'Res.': [679, 698, 948, 980, 3512, 3544, 3915, 3944], '1994;': [680, 699], '101:': [681, 700], 'xi-xivCrossref': [682, 701], '(106)': [685, 704], 'Scholar).has': [706], 'so': [707], 'far': [708], 'highest': [711], 'affinity': [712], 'Scholar)': [750, 1097, 1136, 1232, 3120], 'most': [752, 3669], 'serotypes': [757, 1101], '(8Kitamura': [758], 'M.': [759, 761, 780, 782, 868, 888, 1044, 1046, 1087, 2317, 2319, 2364, 3432, 3452, 3611, 3613, 3899], 'Iwamori': [760, 781, 1045, 2318, 3612], 'Nagai': [762, 783, 1047, 2320, 3614], 'Y.': [763, 784, 800, 802, 1048, 1124, 1140, 1142, 2321, 3615], 'Biochim.': [764, 1149], 'Biophys.': [765, 947, 1150, 3511], 'Acta.': [766, 1151], '628:': [768], '328-335Crossref': [769], '(124)': [772], '9Kozaki': [775], 'Sakaguchi': [777, 803, 966, 1041, 1127, 1145, 2314, 3530, 3608], 'G.': [778, 804, 967, 1042, 1128, 1146, 2315, 3531, 3609], 'Nishimura': [779, 1043, 2316, 3610], 'FEMS': [785, 1021, 1049, 2322, 3585, 3616], 'Lett.': [787, 1023, 1051, 2324, 3587, 3618], '1984;': [788, 1052, 2325, 3619], '211:': [789, 1053, 2326, 3620], '219-223Crossref': [790, 1054, 2327, 3621], '(21)': [792, 1056, 2329, 3623], '10Kozaki': [795], 'Ogasawara': [797, 1125], 'Shimote': [799], 'Kamata': [801, 1123], 'Infect.': [805, 1129, 3272], 'Immun.': [806, 1130, 3273], '1987;': [807], '55:': [808], '3051-3056Crossref': [809], 'Scholar),': [812, 1028, 1058, 3279, 3592, 3625], 'although': [813, 1278, 2487], 'species': [815, 2435, 2453, 2619, 3783], 'higher': [817, 2475], 'affinities': [818], 'exist.Considerable': [820], 'progress': [821], 'has': [822], 'made': [824], 'defining': [826], 'peptide': [829, 1235, 1408, 1722, 1765, 2182, 2868, 3056, 3150, 3154, 3160, 3183, 3191, 3215, 3232, 3251, 3309, 3365], 'sequences': [830, 2291, 3407, 3812, 3834], 'necessary': [831, 3835], 'both': [835, 3166], 'high': [842], 'degree': [843], 'sequence': [847, 2185, 2193, 2258, 2346, 3663], 'homology': [848], 'across': [849], '7': [851, 3388], 'cloned': [852], '(11Eisel': [855, 2351, 3419], 'U.': [856, 866, 2352, 2362, 3269, 3420, 3430, 3925], 'Jarausch': [857, 2353, 3421], 'W.': [858, 2354, 3422], 'Goretzki': [859, 2355, 3423], 'K.': [860, 892, 929, 933, 941, 945, 971, 1085, 2356, 3424, 3456, 3493, 3497, 3505, 3509, 3535, 3897], 'Henschen': [861, 972, 2357, 3425, 3536], 'A.': [862, 973, 1122, 1220, 2358, 3108, 3426, 3537], 'Engels': [863, 2359, 3427], 'Weller': [865, 2361, 3429], 'Hudel': [867, 2363, 3431], 'Habermann': [869, 2365, 3433, 3928], 'EMBO': [873, 2369, 3437], '5:': [876, 2372, 3440], '2495-2502Crossref': [877, 2373, 3441], '(205)': [880, 2376, 3444], '12Binz': [883, 3447], 'T.': [884, 916, 935, 937, 959, 996, 1144, 3263, 3267, 3448, 3480, 3499, 3501, 3523, 3560], 'Kurazono': [885, 960, 3264, 3449, 3524], 'Wille': [887, 3451], 'Frevert': [889, 3453], 'Wernars': [891, 3455], '1990;': [898, 950, 981, 3462, 3514, 3545], '265:': [899, 3463], '9153-9158Abstract': [900, 3464], '13Whelan': [907, 3471], 'S.M.': [908, 990, 3472, 3554], 'Elmore': [909, 991, 3473, 3555], 'M.J.': [910, 992, 3474, 3556], 'Bodsworth': [911, 993, 3475, 3557], 'N.J.': [912, 994, 1108, 3476, 3558], 'Brehm': [913, 3477], 'J.K.': [914, 3478], 'Atkinson': [915, 995, 3479, 3559], 'Minton': [917, 997, 3481, 3561], 'Appl.': [919, 3483], 'Envir.': [920, 3484], '1992;': [922, 1002, 1024, 3486, 3566, 3588], '58:': [923, 3487], '2345-2354Crossref': [924, 3488], '14Kimura': [928, 3492], 'Fujii': [930, 3494], 'N.': [931, 939, 3495, 3503], 'Tsuzuki': [932, 3496], 'Murakami': [934, 3498], 'Indoh': [936, 3500], 'Yokosawa': [938, 3502], 'Takeshi': [940, 3504], 'Syuto': [942, 3506], 'B.': [943, 1083, 3261, 3507, 3895], 'Oguma': [944, 3508], 'Commun.': [949, 3513], '171:': [951, 3515], '1304-1311Crossref': [952, 3516], '(52)': [955, 3519], '15Binz': [958, 3522], 'Popoff': [962, 3526], 'M.R.': [963, 3527], 'Eklund': [964, 3528], 'M.W.': [965, 3529], 'Kozaki': [968, 1147, 3532], 'Krieglstein': [970, 3534], 'Gill': [974, 3538], 'D.M.': [975, 3539], 'Nucleic': [978, 3542], 'Acids': [979, 3543], '18:': [982, 3546], '5556Crossref': [983, 3547], '(86)': [986, 3550], '16Whelan': [989, 3553], '191:': [1003, 3567], '657-667Crossref': [1004, 3568], '(82)': [1006, 3570], '17East': [1009, 3573], 'A.K.': [1010, 3574], 'Richardson': [1011, 3575], 'P.T.': [1012, 3576], 'Allaway': [1013, 3577], 'D.': [1014, 3578], 'Collins': [1015, 3579], 'M.D.': [1016, 3580], 'Roberts': [1017, 3581], 'T.A.': [1018, 3343, 3582], 'Thompson': [1019, 3583], 'D.E.': [1020, 3584], '96:': [1025, 3589], '225-230Crossref': [1026, 3590], 'combined': [1029], 'conservation': [1032, 3628], 'among': [1036, 3386], 'these': [1037, 1617, 3087, 3196, 3826], '(9Kozaki': [1039, 2312, 3606], 'suggests': [1059, 1797, 3376], 'conserved': [1062], 'motif': [1065], 'common': [1069], 'site': [1072, 2203, 2753, 3674], 'toxin-ganglioside': [1075, 3236, 3254], 'For': [1077], 'three': [1078], '(tetanus': [1080, 3036], '(18Bizzini': [1082, 3894], 'Stoeckel': [1084, 3896], 'Schwab': [1086, 3898], 'Neurochem.': [1089, 1110, 3901], '1977;': [1090, 3902], '28:': [1091, 3903], '529-542Crossref': [1092, 3904], '(91)': [1095, 3907], 'A': [1102, 1321, 2588, 3082], '(19Schengrund': [1103], 'C.-L.': [1104], 'DasGupta': [1105], 'B.R.': [1106], 'Ringler': [1107], '1991;': [1111, 3351], '57:': [1112, 1132, 3275], '1024-1032Crossref': [1113], '(57)': [1116], '20Kozaki': [1119], 'Miki': [1121], '1989;': [1131, 3274], '2634-2639Crossref': [1133], 'E': [1138, 3758], '(21Kamata': [1139], 'Kimura': [1141], 'Hiroi': [1143], '1993;': [1152, 1224, 3112], '1156:': [1153], '213-218Crossref': [1154], '(14)': [1157], 'Scholar)),': [1159], 'supported': [1163, 3185], 'isolated': [1166, 1908], '(≈50': [1169], 'kDa)': [1170], 'respective': [1173], 'chains.': [1175], 'This': [1176, 1649, 2192, 2748, 3805], 'region': [1177], 'commonly': [1182], 'termed': [1183], '"C': [1185], 'fragment"': [1186], 'roughly': [1188], 'comprises': [1189], 'acids': [1191, 2198, 2242, 2281, 2518, 2679, 2706, 2744, 2917, 3030, 3090, 3177, 3201, 3283, 3339, 3765], '864–1315': [1192], 'Scholar).Recently,': [1208], 'highly': [1211], 'informative': [1212], 'study,': [1213], 'Halpern': [1214, 3102], 'Loftus': [1216, 1219, 3104, 3107], '(22Halpern': [1217, 3105], 'J.L.': [1218, 3106], '268:': [1225, 3113], '11188-11192Abstract': [1226, 3114], 'synthesized': [1233, 2395], 'various': [1234], 'fragments': [1236, 1601, 2098, 2123, 2137, 2661, 2675, 2729, 3132], 'near': [1237, 3680, 3704, 3746], 'carboxyl': [1239, 1411, 2207, 2252], 'terminus': [1240, 1412, 2208], 'measured': [1245], 'their': [1246, 2303, 3240, 3597, 3661, 3770], 'immobilized': [1249], 'neurons': [1253, 3134], 'physiological': [1255, 3139], 'pH': [1256, 3140, 3702, 3740], 'ionic': [1258, 3142], 'strength.': [1259, 3143], 'indicated': [1262, 1899, 2017, 2180, 2699, 2749, 2862], 'mediated': [1267], 'portion': [1271], 'fragment,': [1277, 1693, 2275, 3856], 'contributions': [1279], 'protein': [1281, 1394], 'secondary': [1282], 'tertiary': [1284], '(e.g.': [1288, 2491, 3648, 3877], 'interactions': [1289], 'non-contiguous': [1291], 'sequences)': [1293], 'significant.To': [1296], 'extend': [1297], 'analysis,': [1299], 'ganglioside-based': [1304], 'ligand': [1306, 1350, 2631], 'identify': [1308, 1404], 'gangliosides.': [1320, 3053], 'radioiodinated': [1322], 'aryl': [1323], 'azide': [1324, 2485], 'derivative': [1325], 'GD1b': [1327], '(125I-azido-GD1b)': [1329], 'synthesized,': [1331], 'incubated': [1332], 'solution,': [1339], 'then': [1341, 1364, 1597, 1683, 1984, 1986, 2961, 3823], 'photolyzed,': [1345], 'thereby': [1346], 'covalently': [1347], 'fixing': [1348], 'presumptive': [1354], 'site(s).': [1356], 'photoaffinity-labeled': [1358], 'enzymatically': [1365], 'resultant': [1369], 'peptides': [1371, 2840, 2864, 2970, 3224], 'sequenced.': [1374], 'An': [1375], 'advantage': [1376], 'azido-GD1b': [1378, 2425, 2466, 2479, 2554, 2947], 'labeling': [1380, 1425, 1478, 1748, 1780, 1968, 2983, 3073, 3313, 3677], 'performed': [1387, 1756, 2461, 2884, 3077], 'prior': [1388, 1464, 3078], 'fragmentation,': [1391], 'while': [1392, 3857], 'its': [1397, 2235, 2523, 3330, 3335, 3873], 'native': [1398, 3868], 'conformation.': [1399], 'technique': [1402], 'demonstrate': [1422], 'His1293.RESULTSIncubation': [1427], 'photoflash': [1436], 'activation,': [1437], 'produced': [1438], 'co-migrated': [1445, 1651], '(Fig.3': [1452], 'A).': [1453, 1586], 'preincubated': [1460, 1558, 1602], '125I-azido-GD1b,': [1468, 1572], '(Fig.': [1472, 1511, 1584, 1611, 2212, 2413, 2445, 2669, 3637, 3773], '3': [1473, 1512, 2614], 'B).': [1474, 1613], 'Half-maximal': [1475], 'inhibition': [1476, 1522, 1534], 'of125I-azido-GD1b': [1477], 'occurred': [1484, 1789, 3314], '≈1': [1486], 'μm': [1487, 1503, 1526, 1564, 1847], 'Preincubation': [1489], 'GM3': [1497, 1852], 'concentration': [1500], '50': [1502], 'without': [1505, 3238], 'significant': [1506], 'effect': [1507], 'subsequent': [1509, 3883], 'B),': [1513], 'whereas': [1514, 2128, 2736], 'preincubation': [1515], 'GM1': [1518], 'resulted': [1519, 2428], 'half-maximal': [1521], 'approximately': [1524], '10': [1525, 1563, 1846], '(data': [1527, 1955, 2467, 2632], 'shown),': [1529, 2634], 'consistent': [1530, 2233, 2436, 2571, 2658], 'previously': [1532], 'published': [1533], 'Scholar).Tetanus': [1551], '(1': [1555, 1827, 2004], 'μg/reaction)': [1556, 1828, 2005], '(without': [1559], 'inhibitor': [1560], 'either': [1566], 'GM3),': [1569], 'reacted': [1570], 'polypeptides': [1579, 2811], 'subjected': [1580, 1874, 2044, 2139, 2175], 'Tricine': [1582, 1620, 1871, 2040, 2107], 'SDS-PAGE': [1583, 1621, 1872, 2041, 2108], '4': [1585, 1612], 'Alternately,': [1587], 'first': [1593, 1680, 2956], 'mixture': [1599], 'inhibitors': [1604, 1838, 2019], '(as': [1605], 'indicated)': [1606], 'with125I-azido-GD1b': [1610, 1832, 2009, 2227], 'Autoradiographic': [1614], 'analysis': [1615], 'reactions': [1618, 1705, 1867, 1915, 1943, 2034, 2623], 'only': [1623, 1690, 2621, 2737, 3158, 3862], 'one': [1624, 2702, 3760], 'GT1b,': [1633, 1937, 1945], 'regardless': [1634], 'with125I-azido-GD1b.': [1648], 'detected': [1656, 2455, 2601, 2819, 2841, 2871], 'Coomassie': [1658], 'Blue': [1659], 'staining': [1660], 'unlabeled': [1662, 2073, 2084, 2094, 2135, 2169], 'electrophoresed': [1668], 'adjacent': [1671, 1894, 1903, 2102], 'lane': [1672, 2166], '(not': [1673, 2426], 'shown).': [1674, 1716, 2469], 'In': [1675, 1913, 2066, 3242], 'sample': [1677], 'labeled,': [1682], 'proteolyzed,': [1684], 'appeared': [1686, 1702, 1940, 2490], 'other': [1696, 1799, 3223], 'bands': [1698], 'lipid-related': [1700], '(they': [1701], 'control': [1704], 'excluded,': [1713], 'results': [1718, 2179, 3096, 3295], 'suggest': [1719], 'binds': [1727], 'to125I-azido-GD1b': [1728], 'manner': [1731, 2231], 'inhibitable': [1735], '(GT1b).': [1740], 'observation': [1742, 1776, 2720], 'comparable': [1745, 1782, 2451, 3767], 'pattern': [1746], '125I-azido-GD1b': [1753, 1817, 2273], 'proteolysis': [1760, 1794, 2071, 3075], 'indicates': [1761, 3626], 'mediate': [1769, 3634], '(see': [1772, 1911, 2056, 2823, 2876, 2948, 2991], 'below).': [1773], 'Furthermore,': [1774, 3693], 'quantitatively': [1778], 'greater': [1779], 'amounts': [1783], 'if': [1790, 2456, 3074], 'the125I-azido-GD1b': [1791], '(Table': [1795], 'I)': [1796], 'attenuate': [1805], 'binding.Figure': [1807], '4Proteolysis': [1808], 'labeling.Intact': [1818], '(A)': [1819], 'clostripain-proteolyzed': [1821, 1999, 2093], '(B)': [1822], 'absence': [1835, 2014, 2464], '(lanes': [1839, 1849, 1853, 1918], '1),': [1840, 2685, 2799], 'presence': [1844, 2012, 3174, 3360], '2)': [1850, 2546], '3).': [1854, 2449, 2806], 'Radiolabeled': [1855, 2022], 'intact': [1856, 2023, 2348, 3061], 'subsequently': [1862, 1907, 2029], 'digested': [1863, 2030], 'clostripain.': [1865, 2032], 'resolved': [1869, 2036, 2100], 'PhosphorImager': [1876, 2046], 'analysis.': [1877, 2047], 'migration': [1879], 'position': [1880, 2989], 'unique': [1883], 'clostripain': [1884, 2053, 2070, 2201, 2216, 2261], 'proteolytic': [1885, 1904, 1929, 2262, 2660], 'product': [1886, 2055, 2218, 2263], '(resolved': [1892], 'lanes,': [1895], 'shown)': [1897, 2499], 'arrows.': [1901], 'sequenced': [1910], 'text).': [1912], '2),': [1919, 2691, 2802], 'migrates': [1924], 'just': [1925], 'slower': [1926], 'than': [1927], 'artifact': [1933], '125I-azido-GD1breaction': [1935], 'since': [1938, 3069, 3214], 'it': [1939], 'all': [1942, 3392], 'including': [1946], 'those': [1947, 3666], 'omitted': [1954], 'shown).View': [1957], 'Large': [1958, 2379, 2640, 2828, 3015], 'Image': [1959, 2380, 2641, 2829, 3016], 'Figure': [1960, 2381, 2642, 2830, 2925, 3017], 'ViewerDownload': [1961, 2382, 2643, 2831, 3018], 'Hi-res': [1962, 2383, 2644, 2832, 3019], 'image': [1963, 2384, 2645, 2833, 3020], 'Download': [1964, 2385, 2646, 2834, 3021], '(PPT)Table': [1965, 2835], 'I125I-Azido-GD1b': [1966], 'proteolysisInhibitorRadiolabel': [1977], 'polypeptideLabeled': [1983], 'proteolyzedProteolyzed': [1985], 'labeledrelative': [1987], 'units': [1988], '(%of': [1989], 'control)None28.4': [1990], '(100)169': [1991], '(100)GT1b': [1992], '0': [1993], '(0)49': [1994], '(29)GM354.3': [1995], '(191)197': [1996], '(116)Intact': [1997], '(10': [2020], 'μm).': [2021], 'All': [2033], 'same': [2039, 2106, 2458], 'Radiolabel': [2048], 'cleavage': [2054, 2202, 2217, 2882, 2975], 'text)': [2057], 'quantified.': [2059], 'Open': [2060, 2919], 'table': [2061, 2920], 'new': [2064, 2433, 2923], 'tab': [2065, 2924], 'separate': [2068], 'experiment,': [2069], 'repeated': [2079], 'using': [2080], '20': [2081], 'μg': [2082], 'per': [2089], 'reaction.125I-azido-GD1b-labeled': [2090], 'lanes': [2103, 2133], 'gel.': [2109], 'Following': [2110], 'electrophoresis,': [2111], 'sliced': [2115], 'half.': [2117], 'side': [2119, 2130], 'analyzed': [2125], 'electrotransfer': [2141], 'polyvinylidene': [2144, 2159], 'difluoride': [2145, 2160], 'membrane.': [2146], 'Based': [2147], 'mobility': [2150, 3876], 'GT1b-inhibitable': [2153, 2230], 'band,': [2155], 'rectangle': [2157], 'excised': [2163], 'from': [2164, 2538, 2730, 2972, 3225, 3323, 3657], 'microsequencing.': [2177], 'amino-terminal': [2184], 'DILIASNXYFNHLKDKILG': [2186], '(where': [2187], 'X': [2188], 'represents': [2189], 'no': [2190], 'determination).': [2191], 'corresponds': [2194], 'following': [2199], 'closest': [2204], '5).': [2213, 3638], 'Therefore': [2214], 'identification': [2236, 3845], 'toxin:': [2245], 'DILIASNWYFNHLKDKILGCDWYFVPTDEGWTND': [2246], '(Fig.5).Figure': [2247], '5Sequence': [2248], 'comparisons': [2249], 'termini': [2253], 'toxins.': [2256], 'co-migrates': [2270], 'toxin,': [2284, 2521, 3870], 'shown.': [2286], 'Six': [2287], 'included': [2293, 3305], 'comparison,': [2295], 'rank': [2297, 3594], 'order': [2298, 3595], '(top': [2299], 'bottom)': [2301], 'reported': [2304, 3122, 3598], 'abilities': [2305, 3600], 'inactivated': [2308, 3603], 'Sequence': [2332], 'similarity': [2333], '(indicated': [2334], 'byshading)': [2335], 'BOXSHADE': [2339], '(http://ulrec3.unil.ch/software/BOX_form.html).': [2340], 'Numbersrelate': [2341], 'Scholar).View': [2378], '(PPT)The': [2386], 'reverse': [2399], 'phase': [2400], 'chromatography.': [2401], 'MALDI-MS': [2402], 'appropriate': [2405], 'calculated': [2406], 'molecular': [2407, 2434, 2452, 2574, 2582], 'underivatized': [2411, 2530, 2567, 2739], '6,': [2414, 2493, 2878, 3710], 'spectrum': [2415, 2494, 2564, 2613, 2684, 2690, 2697, 2998], '1).': [2416], 'Incubation': [2417, 2470], 'equimolar': [2419, 2544], '2-fold': [2421, 2548], 'molar': [2422, 2476, 2549, 2626], 'excess': [2423, 2550, 2627], 'radiolabeled)': [2427], 'production': [2430], 'covalent': [2438], '2-(p-aminosalicylamido)ethanethiol': [2443, 2598, 2816], '6,spectra': [2446], '2': [2447, 2604], 'No': [2450], 'incubation': [2459, 2539], 'ratios': [2477], 'did': [2480, 2501, 3193], 'result': [2482], 'multiple': [2484], 'derivatization,': [2486], 'additional': [2488, 2608], 'masses': [2489, 2570, 2657, 2869], 'Fig.': [2492, 2682, 2688, 2695, 2788, 2949, 3043], '3,': [2495], 'correspond': [2503, 2912], 'polypeptide.Figure': [2506], '6MALDI-MS': [2507], 'corresponding': [2512, 2590, 2676, 2741, 2762, 2808, 2968, 3085], 'derivative.': [2526], 'Spectra': [2527], '34-mer': [2531], '(spectrum': [2533, 2545, 2551, 2798, 2801, 2805], '1)': [2534], 'products': [2536], 'resulting': [2537, 2971], '3)': [2552, 2698], 'obtained': [2556], 'described': [2558], 'under': [2559, 2891], '"Materials': [2560, 2892], 'Methods."': [2562, 2894], 'ion': [2575, 2583], '(M': [2576], '+': [2577], 'H,': [2578], '4091.5)': [2579], 'less': [2584], 'hydroxyl': [2586], '(4074.5).': [2587], 'peak': [2589, 2611], 'derivatized': [2594, 2662, 2728, 2785, 2812, 2945], 'spectra': [2603], '3.': [2606], 'mass/charge': [2609], '4132.0': [2610], 'doubly': [2617], 'charged': [2618], 'apparent': [2620], 'having': [2624], '≥2-fold': [2625], 'considered': [2637], 'artifact.View': [2639], '(PPT)Proteolysis': [2647], 'azide-derivatized': [2650], 'probe': [2655, 2794, 2888, 2955], '2-(p-aminosalicylamido)': [2666], 'ethanethiol': [2667], '7,': [2670, 2683, 2689, 2696, 2879], 'TableII).': [2671], 'Appearance': [2672], '2–14': [2680], '(GluC,': [2681], '1–16': [2686, 2731], '(trypsin,': [2687], '11–22': [2693], '(chymotrypsin,': [2694], 'derivatization': [2700, 2756], 'between': [2707], '11': [2708], '14.': [2710], 'Carboxypeptidase': [2711], 'P': [2712, 2931, 2964], 'treatment': [2713], 'trypsin': [2716, 2800, 2928, 2958], 'confirmed': [2718], '(Fig.8,': [2721], 'Table': [2722, 2824, 2992], 'II),': [2723], 'sequentially': [2726], 'cleaved': [2727], '1–12': [2733], 'detected,': [2735, 2980], '1–11': [2745], 'found.': [2747], 'azido': [2755], '12,': [2761], 'His1293': [2764, 3745], 'sequence.Figure': [2769], '7MALDI-MS': [2770], 'polypeptide.': [2775, 2935], 'azido-GD1b(see': [2787], '6)': [2789, 2950], 'treated': [2791, 2952], 'endoproteinase': [2796, 2901], 'GluC': [2797], 'chymotrypsin': [2804], 'Masses': [2807, 2967], 'expected': [2810], 'each': [2821], 'case': [2822], 'II': [2825], 'interpretation).View': [2827], 'IIPeptides': [2836], 'MALDI': [2843, 2873], 'spectrometryPeptideResiduesEnzymeAzidoCalculated': [2845], 'massObserved': [2846], 'massDaDILIASNWYFNHLKDKILGCDWYFVPTDEGWTND': [2847], '(+H)1–34−−4091.54091.6DILIASNWYFNHLKDKILGCDWYFVPTDEGWTND': [2848], '(+Na)1–34−+4323.84329.2DILIASNWYFNHLKDK': [2849], '(+H)1–16Tryp+2188.52189.2': [2850], 'ILIASNWYFNHLKD': [2851], '(+H)2–14GluC+1945.21943.8NHLKDKILGCDWY': [2852], '(+H)11–23Chym+1816.11815.5NHLKDKILGCDW': [2853], '(+H)11–22Chym+1652.91652.3DILIASNWYFNHLKD': [2854], '(+H)1–15Tryp/CP+2060.32059.3DILIASNWYFNHLK': [2855], '(+H)1–14Tryp/CP+1945.21944.0DILIASNWYFNHL': [2856], '(+H)1–13Tryp/CP+1817.11812.7DILIASNWYFNH': [2857], '(+H)1–12Tryp/CP+1703.91702.7DILIASNWYFN': [2858], '(+H)1–11Tryp/CP+1566.8Not': [2859], 'foundDILIASNWYFN': [2860], '(+Na)1–11Tryp/CP−1378.51377.5The': [2861], 'Figs.': [2877], '8).': [2880], 'Enzymatic': [2881], 'spectrometer': [2887], 'detailed': [2890], 'Enzymes': [2895], 'used': [2896], 'were:': [2897], 'Tryp,': [2898], 'trypsin;': [2899], 'GluC,': [2900], 'GluC;': [2902], 'Chym,': [2903], 'chymotrypsin;': [2904], 'CP,': [2906], 'carboxypeptidase': [2907, 2930, 2963], 'Peptide': [2909], '1–34': [2911], '1282–1315.': [2918], '8MALDI-MS': [2926], '(5': [2959], 'min)': [2960], '(90': [2965], 's).': [2966], 'sequential': [2973], '(1–16': [2976], '1–11)': [2978], 'indicating': [2981, 3156], 'His': [2986], '12': [2990], 'IIfor': [2993], 'interpretation).': [2994], 'Areas': [2995], 'surrounding': [2999], 'peaks': [3000], '1377.5,': [3002], '1702.7,': [3003], '1812.7': [3005], 'expanded': [3007], '5-fold,': [3008], 'indicated,': [3010], 'reveal': [3012], 'key': [3013], 'fragments.View': [3014], '(PPT)DISCUSSIONOur': [3022], 'findings': [3023, 3100], 'indicate': [3024, 3198, 3296], '1282–1315,': [3041, 3310], '5)': [3044], 'Moreover,': [3054], 'superior': [3058], 'supporting': [3066, 3372], 'there': [3070, 3378], 'greater125I-azido-GD1b': [3072], 'labeling.': [3081], 'photolabeled': [3093], 'azido-GD1b.These': [3095], 'agree': [3097], 'who': [3121], 'structure-activity': [3123], 'relationships': [3124], 'recombinant': [3129], 'They': [3144], 'found': [3145, 3817], 'markedly': [3146], 'enhanced': [3147], '1120–1315': [3151, 3161], 'relative': [3152, 3599], '858–1315,': [3155], 'neuron': [3167], '858–1119': [3178], 'inhibits': [3179], 'such': [3180], 'Whereas': [3182], '858–1310': [3184], 'neurons,': [3190], '858–1305': [3192], 'not.': [3194], 'Although': [3195], '1306–1310': [3202], 'required': [3204], 'they': [3207], 'bind': [3210, 3688], '1296–1315': [3216, 3233], 'neither': [3217], 'bound': [3218, 3234], 'nor': [3221], 'blocked': [3222], 'monoclonal': [3229, 3245], 'antibody': [3230, 3246], 'against': [3231], 'complexes': [3237], 'inhibiting': [3239], 'interaction.': [3241], 'contrast,': [3243], 'recognizing': [3247], 'epitope': [3249], '1236–1315': [3252], 'toxin-mediated': [3258], '(29Andersen-Beckh': [3260], 'Binz': [3262], 'Mayer': [3266], 'Eisel': [3268], '3498-3505Crossref': [3276], 'suggesting': [3280], '1236–1295': [3285], 'particularly': [3288], 'critical': [3289, 3299], 'direct': [3291], 'Our': [3294], 'predominantly': [3315], '1293.': [3318], 'structurally': [3320], 'unrelated': [3321], 'enterotoxin': [3322], 'another': [3324], 'Clostridialspecies': [3325], '(Clostridium': [3326], 'perfringens)': [3327], 'also': [3328, 3872], 'encodes': [3329], 'function': [3333], '30': [3337], '(30Hanna': [3340], 'P.C.': [3341], 'Mietzner': [3342], 'Schoolnik': [3344], 'G.K.': [3345], 'McClane': [3346], 'B.A.': [3347], '266:': [3352], '11037-11043Abstract': [3353], 'Scholar).The': [3359], 'capable': [3369], 'independently': [3371], 'oligosaccharide': [3382], 'shared': [3385], 'possess': [3398], 'some': [3399, 3889], 'activity.': [3402], 'Alignment': [3403], '6': [3410], 'particular': [3630], 'Those': [3639], 'functionally': [3642], 'interact': [3643], 'least': [3645], 'Types': [3650], 'D)': [3653], 'more': [3655, 3762], 'divergent': [3656], 'compared': [3664], '(His1293)': [3678], 'two': [3681], 'lysine': [3682], '(Lys1295and': [3684], 'Lys1297)': [3685], 'carboxylate(s).': [3692], 'exhibits': [3700], 'maximum': [3703], 'pK': [3706], 'histidine': [3708], '(pH': [3709], 'Ref.': [3711], 'Enhanced': [3736], 'low': [3739], 'reflect': [3742], 'protonation': [3743], 'pocket.': [3751], 'Botulinum': [3752], 'B,': [3754], 'F,': [3755], 'A,': [3756], 'cationic': [3763], 'positions': [3768], '5).All': [3774], 'above': [3777], 'encoded': [3780], 'episomally': [3781], 'withinClostridial': [3782], '(i.e.': [3784], 'phage': [3786], 'plasmid)': [3788], 'fact': [3806], 'raises': [3807], 'possibility': [3809], 'originally': [3815], 'host': [3820], 'genes,': [3821], 'adopted': [3824], 'bacteria.': [3827], 'Consequently,': [3828], 'definition': [3829], 'aid': [3843], 'similar': [3850], 'functions.Tetanus': [3853], 'itself': [3858], 'nontoxic,': [3859], 'retains': [3860], 'activity': [3866], 'cytologic': [3875], 'retrograde': [3879, 3884], 'transport': [3881, 3892], 'transynaptic': [3885], 'transfer),': [3886], 'albeit': [3887], 'loss': [3890], 'efficiency': [3893], '31Schwab': [3910], 'M.E.': [3911], 'Thoenen': [3912], '1976;': [3916], '105:': [3917], '213-227Crossref': [3918], '(99)': [3921], '32Weller': [3924], 'Taylor': [3926], 'C.F.': [3927], 'Toxicon.': [3930], '24:': [3932], '1055-1063Crossref': [3933], '(34)': [3936], '33Evinger': [3939], 'C.': [3940], 'Erichsen': [3941], '380:': [3946], '383-388Crossref': [3947]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2089191180', 'counts_by_year': [{'year': 2024, 'cited_by_count': 3}, {'year': 2023, 'cited_by_count': 1}, {'year': 2021, 'cited_by_count': 1}, {'year': 2020, 'cited_by_count': 1}, {'year': 2018, 'cited_by_count': 2}, {'year': 2017, 'cited_by_count': 2}, {'year': 2016, 'cited_by_count': 2}, {'year': 2015, 'cited_by_count': 3}, {'year': 2014, 'cited_by_count': 3}, {'year': 2013, 'cited_by_count': 3}, {'year': 2012, 'cited_by_count': 5}], 'updated_date': '2025-01-05T07:48:51.889930', 'created_date': '2016-06-24'}