Publication Information

{'id': 'https://openalex.org/W2170965251', 'doi': 'https://doi.org/10.1074/jbc.m100482200', 'title': 'p53 Latency', 'display_name': 'p53 Latency', 'publication_year': 2001, 'publication_date': '2001-05-01', 'ids': {'openalex': 'https://openalex.org/W2170965251', 'doi': 'https://doi.org/10.1074/jbc.m100482200', 'mag': '2170965251', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/11279079'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m100482200', 'pdf_url': 'http://www.jbc.org/article/S0021925819319726/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925819319726/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5039161354', 'display_name': 'T. V. Yakovleva', 'orcid': 'https://orcid.org/0000-0003-3238-2317'}, 'institutions': [], 'countries': [], 'is_corresponding': False, 'raw_author_name': 'Tatiana Yakovleva', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5111743511', 'display_name': 'Aladdin Pramanik', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I4210150971', 'display_name': 'Institute of Molecular Biology and Biophysics', 'ror': 'https://ror.org/051f11n17', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1313323035', 'https://openalex.org/I4210110862', 'https://openalex.org/I4210150971']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Aladdin Pramanik', 'raw_affiliation_strings': ['Department of Medical Biochemistry and Biophysics, and the'], 'affiliations': [{'raw_affiliation_string': 'Department of Medical Biochemistry and Biophysics, and the', 'institution_ids': ['https://openalex.org/I4210150971']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5060091612', 'display_name': 'Takashi Kawasaki', 'orcid': 'https://orcid.org/0000-0003-0193-3040'}, 'institutions': [{'id': 'https://openalex.org/I28166907', 'display_name': 'Karolinska Institutet', 'ror': 'https://ror.org/056d84691', 'country_code': 'SE', 'type': 'education', 'lineage': ['https://openalex.org/I28166907']}], 'countries': ['SE'], 'is_corresponding': False, 'raw_author_name': 'Takashi Kawasaki', 'raw_affiliation_strings': ['Microbiology and Tumor Biology Center, Karolinska Institute and the'], 'affiliations': [{'raw_affiliation_string': 'Microbiology and Tumor Biology Center, Karolinska Institute and the', 'institution_ids': ['https://openalex.org/I28166907']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5049438575', 'display_name': 'Koichi Tan‐No', 'orcid': 'https://orcid.org/0000-0001-6724-848X'}, 'institutions': [], 'countries': [], 'is_corresponding': False, 'raw_author_name': 'Koichi Tan-No', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5039360340', 'display_name': 'I. P. Gileva', 'orcid': None}, 'institutions': [], 'countries': [], 'is_corresponding': False, 'raw_author_name': 'Irina Gileva', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5008413804', 'display_name': 'Heléne Lindegren', 'orcid': None}, 'institutions': [], 'countries': [], 'is_corresponding': False, 'raw_author_name': 'Heléne Lindegren', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5057501316', 'display_name': 'Ülo Langel', 'orcid': 'https://orcid.org/0000-0001-6107-0844'}, 'institutions': [{'id': 'https://openalex.org/I161593684', 'display_name': 'Stockholm University', 'ror': 'https://ror.org/05f0yaq80', 'country_code': 'SE', 'type': 'education', 'lineage': ['https://openalex.org/I161593684']}], 'countries': ['SE'], 'is_corresponding': False, 'raw_author_name': 'Ülo Langel', 'raw_affiliation_strings': ['Department of Neurochemistry and Neurotoxicology, Stockholm University, Stockholm, Sweden'], 'affiliations': [{'raw_affiliation_string': 'Department of Neurochemistry and Neurotoxicology, Stockholm University, Stockholm, Sweden', 'institution_ids': ['https://openalex.org/I161593684']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5035206639', 'display_name': 'Tomas J. Ekström', 'orcid': 'https://orcid.org/0000-0002-3747-1581'}, 'institutions': [], 'countries': [], 'is_corresponding': False, 'raw_author_name': 'Tomas J. Ekström', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5056284790', 'display_name': 'Rudolf Rigler', 'orcid': 'https://orcid.org/0000-0003-4742-0857'}, 'institutions': [{'id': 'https://openalex.org/I4210150971', 'display_name': 'Institute of Molecular Biology and Biophysics', 'ror': 'https://ror.org/051f11n17', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1313323035', 'https://openalex.org/I4210110862', 'https://openalex.org/I4210150971']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Rudolf Rigler', 'raw_affiliation_strings': ['Department of Medical Biochemistry and Biophysics, and the'], 'affiliations': [{'raw_affiliation_string': 'Department of Medical Biochemistry and Biophysics, and the', 'institution_ids': ['https://openalex.org/I4210150971']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5010768248', 'display_name': 'Lars Terenius', 'orcid': 'https://orcid.org/0000-0003-2880-9576'}, 'institutions': [], 'countries': [], 'is_corresponding': False, 'raw_author_name': 'Lars Terenius', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5058999301', 'display_name': 'Georgy Bakalkin', 'orcid': 'https://orcid.org/0000-0002-8074-9833'}, 'institutions': [], 'countries': [], 'is_corresponding': True, 'raw_author_name': 'Georgy Bakalkin', 'raw_affiliation_strings': ['Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the'], 'affiliations': [{'raw_affiliation_string': 'Experimental Alcohol and Drug Addiction Research Section, Department of Clinical Neuroscience, the', 'institution_ids': []}]}], 'institution_assertions': [], 'countries_distinct_count': 2, 'institutions_distinct_count': 3, 'corresponding_author_ids': ['https://openalex.org/A5058999301'], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 3.022, 'has_fulltext': True, 'fulltext_origin': 'pdf', 'cited_by_count': 47, 'citation_normalized_percentile': {'value': 0.704675, 'is_in_top_1_percent': False, 'is_in_top_10_percent': False}, 'cited_by_percentile_year': {'min': 91, 'max': 92}, 'biblio': {'volume': '276', 'issue': '19', 'first_page': '15650', 'last_page': '15658'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T10583', 'display_name': 'Cancer-related Molecular Pathways', 'score': 0.9998, 'subfield': {'id': 'https://openalex.org/subfields/2730', 'display_name': 'Oncology'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, 'topics': [{'id': 'https://openalex.org/T10583', 'display_name': 'Cancer-related Molecular Pathways', 'score': 0.9998, 'subfield': {'id': 'https://openalex.org/subfields/2730', 'display_name': 'Oncology'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, {'id': 'https://openalex.org/T10269', 'display_name': 'Epigenetics and DNA Methylation', 'score': 0.9952, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11482', 'display_name': 'RNA modifications and cancer', 'score': 0.9929, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/ctd', 'display_name': 'CTD', 'score': 0.8846973}, {'id': 'https://openalex.org/keywords/transcription', 'display_name': 'Transcription', 'score': 0.47642407}], 'concepts': [{'id': 'https://openalex.org/C125533998', 'wikidata': 'https://www.wikidata.org/wiki/Q1024499', 'display_name': 'CTD', 'level': 2, 'score': 0.8846973}, {'id': 'https://openalex.org/C552990157', 'wikidata': 'https://www.wikidata.org/wiki/Q7430', 'display_name': 'DNA', 'level': 2, 'score': 0.6925431}, {'id': 'https://openalex.org/C33987129', 'wikidata': 'https://www.wikidata.org/wiki/Q13479514', 'display_name': 'DNA-binding domain', 'level': 4, 'score': 0.49529782}, {'id': 'https://openalex.org/C179926584', 'wikidata': 'https://www.wikidata.org/wiki/Q207714', 'display_name': 'Transcription (linguistics)', 'level': 2, 'score': 0.47642407}, {'id': 'https://openalex.org/C107824862', 'wikidata': 'https://www.wikidata.org/wiki/Q616005', 'display_name': 'Binding site', 'level': 2, 'score': 0.47420338}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.45095482}, {'id': 'https://openalex.org/C153911025', 'wikidata': 'https://www.wikidata.org/wiki/Q7202', 'display_name': 'Molecular biology', 'level': 1, 'score': 0.43778148}, {'id': 'https://openalex.org/C86339819', 'wikidata': 'https://www.wikidata.org/wiki/Q407384', 'display_name': 'Transcription factor', 'level': 3, 'score': 0.39695248}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.38282982}, {'id': 'https://openalex.org/C95444343', 'wikidata': 'https://www.wikidata.org/wiki/Q7141', 'display_name': 'Cell biology', 'level': 1, 'score': 0.36052048}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.247639}, {'id': 'https://openalex.org/C104317684', 'wikidata': 'https://www.wikidata.org/wiki/Q7187', 'display_name': 'Gene', 'level': 2, 'score': 0.20359832}, {'id': 'https://openalex.org/C111368507', 'wikidata': 'https://www.wikidata.org/wiki/Q43518', 'display_name': 'Oceanography', 'level': 1, 'score': 0.0}, {'id': 'https://openalex.org/C41895202', 'wikidata': 'https://www.wikidata.org/wiki/Q8162', 'display_name': 'Linguistics', 'level': 1, 'score': 0.0}, {'id': 'https://openalex.org/C138885662', 'wikidata': 'https://www.wikidata.org/wiki/Q5891', 'display_name': 'Philosophy', 'level': 0, 'score': 0.0}, {'id': 'https://openalex.org/C127313418', 'wikidata': 'https://www.wikidata.org/wiki/Q1069', 'display_name': 'Geology', 'level': 0, 'score': 0.0}], 'mesh': [{'descriptor_ui': 'D004247', 'descriptor_name': 'DNA', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': True}, {'descriptor_ui': 'D004247', 'descriptor_name': 'DNA', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D016159', 'descriptor_name': 'Tumor Suppressor Protein p53', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': True}, {'descriptor_ui': 'D016159', 'descriptor_name': 'Tumor Suppressor Protein p53', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D001665', 'descriptor_name': 'Binding Sites', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D016384', 'descriptor_name': 'Consensus Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004247', 'descriptor_name': 'DNA', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004399', 'descriptor_name': 'Dynorphins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004399', 'descriptor_name': 'Dynorphins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D006160', 'descriptor_name': 'Guanosine Triphosphate', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006160', 'descriptor_name': 'Guanosine Triphosphate', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': False}, {'descriptor_ui': 'D006801', 'descriptor_name': 'Humans', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D007700', 'descriptor_name': 'Kinetics', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D011993', 'descriptor_name': 'Recombinant Fusion Proteins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011993', 'descriptor_name': 'Recombinant Fusion Proteins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D011993', 'descriptor_name': 'Recombinant Fusion Proteins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D013050', 'descriptor_name': 'Spectrometry, Fluorescence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013050', 'descriptor_name': 'Spectrometry, Fluorescence', 'qualifier_ui': 'Q000295', 'qualifier_name': 'instrumentation', 'is_major_topic': False}, {'descriptor_ui': 'D013050', 'descriptor_name': 'Spectrometry, Fluorescence', 'qualifier_ui': 'Q000379', 'qualifier_name': 'methods', 'is_major_topic': False}, {'descriptor_ui': 'D013379', 'descriptor_name': 'Substrate Specificity', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D016159', 'descriptor_name': 'Tumor Suppressor Protein p53', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m100482200', 'pdf_url': 'http://www.jbc.org/article/S0021925819319726/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/11279079', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m100482200', 'pdf_url': 'http://www.jbc.org/article/S0021925819319726/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 42, 'referenced_works': ['https://openalex.org/W1912742005', 'https://openalex.org/W1963500191', 'https://openalex.org/W1969073916', 'https://openalex.org/W1972302222', 'https://openalex.org/W1974836748', 'https://openalex.org/W1979183493', 'https://openalex.org/W1980655006', 'https://openalex.org/W1987851611', 'https://openalex.org/W1995180922', 'https://openalex.org/W2002292653', 'https://openalex.org/W2006607764', 'https://openalex.org/W2007851973', 'https://openalex.org/W2012518561', 'https://openalex.org/W2013563062', 'https://openalex.org/W2016728250', 'https://openalex.org/W2017984451', 'https://openalex.org/W2020002410', 'https://openalex.org/W2022762967', 'https://openalex.org/W2026277335', 'https://openalex.org/W2054273681', 'https://openalex.org/W2061466767', 'https://openalex.org/W2064308761', 'https://openalex.org/W2065586627', 'https://openalex.org/W2068609288', 'https://openalex.org/W2078920306', 'https://openalex.org/W2078971679', 'https://openalex.org/W2081115041', 'https://openalex.org/W2081446097', 'https://openalex.org/W2084408741', 'https://openalex.org/W2087070363', 'https://openalex.org/W2096079439', 'https://openalex.org/W2096276671', 'https://openalex.org/W2114553575', 'https://openalex.org/W2131246742', 'https://openalex.org/W2137675878', 'https://openalex.org/W2141823032', 'https://openalex.org/W2147620559', 'https://openalex.org/W2148958834', 'https://openalex.org/W2327096119', 'https://openalex.org/W2332825436', 'https://openalex.org/W2414792608', 'https://openalex.org/W2433793816'], 'related_works': ['https://openalex.org/W4251719759', 'https://openalex.org/W4240516289', 'https://openalex.org/W2783711748', 'https://openalex.org/W2750507929', 'https://openalex.org/W2750309893', 'https://openalex.org/W2748723174', 'https://openalex.org/W2370952936', 'https://openalex.org/W2131580913', 'https://openalex.org/W2045822978', 'https://openalex.org/W2030222601'], 'abstract_inverted_index': {'The': [0, 151, 242, 393, 528, 768, 881, 1079, 1180, 1320, 1547, 1690, 1719, 1850, 2147, 2175, 2189, 2213, 2493, 2507, 2534, 2713, 3524, 3635, 3946, 4008, 4253, 4297, 4348, 4425], 'p53': [1, 28, 75, 90, 100, 108, 131, 165, 180, 197, 219, 243, 270, 317, 332, 342, 350, 373, 407, 422, 439, 461, 507, 515, 529, 552, 617, 672, 720, 737, 747, 775, 792, 799, 854, 859, 947, 970, 973, 1101, 1157, 1199, 1207, 1264, 1272, 1284, 1298, 1317, 1483, 1526, 1557, 1764, 1935, 2004, 2032, 2247, 2854, 2987, 3029, 3044, 3136, 3146, 3235, 3461, 3473, 3475, 3487, 3641, 3659, 3669, 3674, 3879, 3901, 3917, 4221], 'transcription': [2, 134, 244, 376, 536, 561, 3313, 3349], 'factor': [3, 135, 245, 377, 537], 'is': [4, 38, 246, 280, 533, 539, 562, 779, 1088, 1103, 1183, 1484, 2538, 2699, 2772, 2780, 2788, 2800, 2810, 2824, 3067, 3426, 3463, 3588, 4011, 4057, 4430], 'either': [5, 49, 247, 291, 3925], 'latent': [6, 218, 248, 460, 535, 678, 804, 946, 3032, 3640], 'or': [7, 54, 249, 296, 833, 974, 1780, 1860, 2021, 2238, 2765, 2770, 2795, 2807, 2816, 2830, 2839, 2850, 2857, 3100, 3179, 3293, 3436, 3651, 3679, 3923, 3927, 4078, 4209, 4219], 'activated': [8, 130, 250, 372, 540, 1485, 3053, 3145, 3217, 3269, 3279, 3352, 3373, 3420], 'through': [9, 251, 588, 602, 4053], 'multi-site': [10, 252], 'phosphorylation': [11, 253, 589, 603], 'and': [12, 65, 86, 101, 104, 116, 132, 139, 187, 189, 205, 254, 307, 328, 343, 346, 358, 374, 381, 429, 431, 447, 741, 856, 1058, 1164, 1268, 1277, 1285, 1318, 1326, 1451, 1475, 1506, 1544, 1567, 1574, 1692, 1700, 1714, 1730, 1740, 1755, 1775, 1868, 1880, 1882, 2009, 2076, 2087, 2134, 2162, 2164, 2169, 2200, 2219, 2227, 2230, 2260, 2312, 2326, 2346, 2366, 2371, 2486, 2495, 2523, 2547, 2588, 2646, 2684, 2767, 2882, 2894, 2920, 2935, 2959, 3059, 3102, 3113, 3122, 3142, 3154, 3162, 3177, 3185, 3211, 3303, 3309, 3329, 3367, 3376, 3446, 3474, 3509, 3522, 3542, 3566, 3569, 3685, 3721, 3738, 3881, 3943, 3967, 3986, 4021, 4108, 4126, 4134, 4142, 4157, 4184, 4246, 4325, 4331, 4370, 4415, 4421, 4467], 'acetylation': [13, 255], 'of': [14, 59, 69, 89, 96, 106, 228, 256, 301, 311, 331, 338, 348, 470, 544, 551, 572, 581, 595, 604, 616, 706, 728, 746, 770, 774, 858, 945, 1056, 1081, 1107, 1170, 1196, 1210, 1263, 1271, 1280, 1313, 1323, 1448, 1471, 1519, 1523, 1698, 1703, 1711, 1855, 1934, 1990, 2003, 2014, 2025, 2028, 2173, 2177, 2191, 2265, 2287, 2290, 2296, 2309, 2316, 2323, 2333, 2361, 2368, 2377, 2384, 2400, 2410, 2414, 2469, 2503, 2541, 2557, 2637, 2687, 2689, 2761, 2783, 2813, 2827, 2853, 2898, 2941, 2983, 3036, 3088, 3095, 3104, 3182, 3286, 3297, 3325, 3337, 3345, 3470, 3500, 3518, 3596, 3608, 3690, 3692, 3718, 3728, 3862, 3865, 3915, 3932, 3949, 3953, 3978, 3984, 3995, 3999, 4028, 4042, 4050, 4062, 4067, 4069, 4080, 4088, 4091, 4113, 4129, 4138, 4162, 4197, 4200, 4230, 4249, 4284, 4288, 4299, 4302, 4308, 4320, 4336, 4350, 4361, 4376, 4428, 4456, 4463], 'the': [15, 51, 60, 67, 70, 84, 158, 226, 229, 257, 293, 302, 309, 312, 326, 400, 468, 471, 565, 570, 605, 611, 707, 712, 729, 743, 771, 791, 798, 846, 887, 968, 1054, 1082, 1095, 1100, 1104, 1108, 1168, 1171, 1186, 1197, 1211, 1261, 1266, 1278, 1311, 1469, 1472, 1517, 1520, 1524, 1540, 1560, 1569, 1712, 1725, 1735, 1988, 2019, 2023, 2128, 2144, 2165, 2178, 2192, 2216, 2251, 2254, 2278, 2288, 2299, 2307, 2314, 2331, 2340, 2500, 2542, 2545, 2558, 2574, 2582, 2585, 2591, 2690, 2694, 2762, 2775, 2781, 2789, 2801, 2811, 2825, 2848, 2851, 2899, 2939, 2942, 3026, 3034, 3047, 3061, 3091, 3267, 3284, 3295, 3321, 3341, 3354, 3417, 3429, 3456, 3460, 3468, 3471, 3478, 3529, 3570, 3575, 3594, 3609, 3617, 3624, 3673, 3716, 3859, 3866, 3878, 3896, 3900, 3916, 3933, 3950, 3976, 3982, 4006, 4019, 4029, 4032, 4043, 4047, 4054, 4063, 4075, 4081, 4101, 4118, 4136, 4172, 4194, 4237, 4250, 4277, 4285, 4300, 4306, 4313, 4351, 4359, 4366, 4373, 4412, 4454, 4457], 'negative': [16, 258, 566], 'regulatory': [17, 72, 259, 314, 567, 709, 1083, 1213], 'region': [18, 73, 260, 315, 568, 587, 710, 735, 1084], 'in': [19, 176, 261, 418, 569, 585, 674, 676, 711, 719, 748, 801, 850, 853, 891, 1085, 1090, 1099, 1177, 1459, 1468, 1499, 1768, 1987, 2018, 2022, 2081, 2244, 2380, 2394, 2417, 2464, 2633, 2847, 2860, 2931, 2993, 3033, 3283, 3294, 3334, 3428, 3598, 3639, 3905, 3975, 3981, 3989, 4005, 4074, 4085, 4117, 4135, 4146, 4171, 4243, 4312], 'its': [20, 35, 185, 203, 262, 277, 427, 445, 842, 1504, 2548, 3105, 3395], 'C-terminal': [21, 263, 484, 597, 715, 2129, 3577, 3610], 'domain': [22, 37, 53, 62, 231, 264, 279, 295, 304, 473, 485, 492, 716, 890, 971, 1173, 1522, 3564, 3611], '(CTD).': [23, 265], 'How': [24, 266], 'CTD': [25, 47, 71, 93, 124, 140, 206, 224, 267, 289, 313, 335, 366, 382, 448, 466, 571, 795, 832, 834, 840, 882, 952, 1044, 1212, 1275, 1473, 1891, 1895, 3620, 3637], 'modifications': [26, 268, 580], 'activate': [27, 74, 161, 269, 316, 403, 590, 972, 3079, 3466, 3582, 3628, 3658, 3668], 'binding': [29, 58, 220, 271, 300, 462, 509, 517, 553, 614, 727, 740, 778, 806, 843, 860, 1166, 1195, 1299, 1487, 2007, 2034, 2248, 2861, 2889, 2988, 3045, 3137, 3236, 3323, 3343, 3369, 3407, 3410, 3481, 3499, 3516, 3556], 'to': [30, 63, 123, 153, 160, 167, 221, 272, 305, 365, 395, 402, 409, 463, 554, 683, 733, 807, 861, 886, 956, 1159, 1200, 1296, 1300, 1309, 1488, 1513, 1538, 1936, 2035, 2143, 2298, 2908, 2989, 3046, 3128, 3138, 3449, 3465, 3553, 3581, 3626, 3643, 3894, 4177, 4236, 4271, 4411, 4418], 'target': [31, 87, 102, 142, 168, 233, 273, 329, 344, 384, 410, 475, 555, 1047, 1175, 1269, 1489, 1528, 3312, 3677, 3882, 3928], 'DNA': [32, 56, 64, 110, 143, 155, 175, 182, 210, 222, 234, 240, 274, 298, 306, 352, 385, 397, 417, 424, 452, 464, 476, 482, 548, 556, 592, 613, 685, 724, 739, 777, 808, 862, 1062, 1161, 1191, 1201, 1286, 1463, 1490, 1497, 1500, 1533, 1729, 2038, 2204, 2990, 3038, 3202, 3289, 3322, 3342, 3368, 3480, 3498, 3515, 3678, 3883, 4143, 4232], 'sequences': [33, 169, 275, 411, 557, 1176, 1938, 2252], 'via': [34, 184, 201, 223, 276, 426, 443, 465, 1162, 1502], 'core': [36, 52, 61, 186, 204, 230, 278, 294, 303, 428, 446, 472, 889, 1172, 1505, 1521, 3567], 'still': [39, 281], 'unknown.': [40, 282], 'It': [41, 283, 782], 'has': [42, 284, 783, 953], 'been': [43, 285, 784, 954, 1577], 'proposed': [44, 286, 785], 'that': [45, 66, 164, 287, 308, 406, 538, 680, 786, 1156, 1188, 1482, 2387, 3073, 3266, 3424], 'nonmodified': [46, 288], 'interacts': [48, 290, 1494], 'with': [50, 55, 78, 99, 109, 149, 157, 172, 207, 232, 238, 292, 297, 320, 341, 351, 391, 399, 414, 449, 474, 480, 504, 790, 829, 1061, 1094, 1174, 1208, 1283, 1316, 1495, 1527, 1531, 1695, 1717, 1787, 1898, 2089, 2127, 2136, 2349, 2407, 2499, 2525, 2564, 2640, 2819, 2833, 2956, 3085, 3124, 3168, 3191, 3205, 3272, 3363, 3382, 3401, 3440, 3590, 3649, 3672, 3676, 3680, 3877, 3924, 4071, 4240, 4260, 4269, 4354], 'preventing': [57, 299], 'fragments': [68, 310, 835, 883, 1276, 1694, 1892], 'by': [76, 92, 111, 117, 194, 318, 334, 353, 359, 436, 541, 564, 599, 787, 948, 1185, 1274, 1709, 1734, 1777, 2184, 2338, 2347, 2356, 2390, 2476, 2512, 2774, 2903, 3054, 3060, 3218, 3222, 3230, 3280, 3353, 3374, 3421, 3670, 3704, 3886, 3938, 3958, 4317], 'interfering': [77, 319], 'these': [79, 321, 2950, 3206], 'interactions.': [80, 322], 'We': [81, 323], 'here': [82, 324], 'characterized': [83, 325, 4316], 'sequence': [85, 327, 1214, 1267, 3396, 3595], 'specificity': [88, 330, 1048, 1270, 2982, 3397], 'activation': [91, 333, 721, 857, 1273, 3159, 3165, 3587, 3597, 3902], 'fragments,': [94, 125, 336, 367, 3107], 'interaction': [95, 227, 337, 469, 789, 1055, 1169, 1518, 3271, 3648], 'activating': [97, 339, 1281, 1314, 1477], 'peptides': [98, 129, 138, 340, 371, 380, 949, 963, 965, 1282, 1315, 2370, 3076, 3084, 3207, 3282, 3356, 3605, 3666], 'DNA,': [103, 345, 1301, 1514, 4468], 'interactions': [105, 171, 214, 347, 413, 456, 1279, 1312, 1450, 3687, 3720, 3864, 3897], '"latent"': [107, 349], 'a': [112, 354, 534, 677, 802, 851, 1460, 1792, 1899, 2362, 2411, 2418, 2451, 2526, 2634, 2994, 3068, 3125, 3180, 3188, 3347, 3441, 3489, 3709, 3729, 3874, 3913, 3959, 3973, 4158, 4247, 4281, 4439], 'band': [113, 355, 1291, 2995, 3526], 'shift': [114, 356, 1292, 2996], 'assay': [115, 357, 1293], 'fluorescence': [118, 360, 486, 1303, 2560, 2565, 2593, 2628, 3951, 4009, 4044, 4254], 'correlation': [119, 361, 487, 1304, 4102], 'spectroscopy.': [120, 362], 'In': [121, 363, 827, 2625, 3858], 'addition': [122, 364], 'several': [126, 368, 596, 4258, 4292], 'long': [127, 208, 369, 450, 1189, 2036], 'basic': [128, 370, 1091, 1851, 3069, 3075, 3083, 3089, 3281, 3457, 3619, 3636, 3869, 4464], 'also': [133, 198, 375, 440, 1045, 3078, 3513, 3910], 'YY1.': [136, 378], 'These': [137, 379, 3970, 4267], 'aggregated': [141, 383], 'but': [144, 236, 386, 478, 1202, 1529, 3228, 3404, 3889], 'apparently': [145, 387, 3527], 'did': [146, 388, 1051, 2396, 4188, 4470], 'not': [147, 237, 389, 479, 780, 1052, 1530, 2397, 3213, 3229, 3358, 3390, 3405, 3558, 3657, 3890, 4186, 4189, 4213, 4234, 4442, 4471], 'interact': [148, 390, 4472], 'p53.': [150, 392, 3080], 'potency': [152, 394], 'aggregate': [154, 396], 'correlated': [156, 398, 2652], 'ability': [159, 401, 3625], 'p53,': [162, 404, 573, 1553, 3317], 'suggesting': [163, 405], 'binds': [166, 408, 1158, 1512], 'upon': [170, 412], 'tightly': [173, 415], 'packed': [174, 416], 'aggregates.': [177, 419, 4364], 'Latent': [178, 196, 420, 438], 'full-length': [179, 421, 1198, 1525, 3472], 'dissociated': [181, 423], 'aggregates': [183, 425, 1467, 1501, 4290, 4429], 'CTD,': [188, 430, 1086, 1163, 1509], 'this': [190, 432, 586, 734, 830, 1165, 2293, 2310], 'effect': [191, 433, 1205, 4192], 'was': [192, 434, 1294, 1307, 1722, 1939, 2039, 2132, 2149, 2167, 2182, 2194, 2304, 2388, 2405, 2462, 2474, 2916, 2974, 2991, 3052, 3166, 3203, 3220, 3278, 3351, 3370, 3892, 3920], 'potentiated': [193, 435], 'GTP.': [195, 437], 'formed': [199, 441, 1466], 'complexes': [200, 442, 3197, 3691, 3735, 4068, 4093], 'both': [202, 444, 1503, 3681], 'nontarget': [209, 451, 1532], 'molecules.': [211, 453, 3682, 4296], 'Such': [212, 454], 'p53-DNA': [213, 455, 2888], 'may': [215, 457, 1515, 3077, 3667, 3908], 'occur': [216, 458], 'if': [217, 459, 1455], 'prevents': [225, 467, 1167], 'sites': [235, 477, 510, 518, 1491, 2249], 'nonspecific': [239, 481, 1190, 2029, 4211], 'sequences.': [241, 483, 1534], 'spectroscopy': [488, 1305], 'big': [489, 1861], 'dynorphin': [490, 495, 1862, 3108], 'N-terminal': [491, 607, 969], 'rhodamine': [493, 2341, 2352, 2364], 'tetramethylrhodamine-big': [494], 'single-stranded': [496, 2267], 'double-stranded': [497, 498, 501, 511, 4203, 4210], 'specific': [499, 1937, 3497, 4204], 'oligonucleotide': [500, 503, 513, 1998, 3225, 3232, 3400, 3929, 4215], '5-carboxytetramethylrhodamine': [502, 512, 2291, 2297], 'wild': [505, 1551, 1555, 2217, 2236, 3402, 4217], 'type': [506, 1552, 1556, 2218, 2237, 3028, 3403, 3486, 4218], 'consensus': [508, 516, 1699, 2005, 2234, 3048, 4222], 'mutant': [514, 961, 1570, 1704, 2220, 2239, 3406, 3573, 4220], 'guanylyl-imidodiphosphate': [519], 'glutathione': [520], 'S-transferase': [521], 'high': [522, 1321], 'pressure': [523], 'liquid': [524], 'chromatography': [525], 'base': [526, 4278], 'pair(s)': [527], 'tumor': [530], 'suppressor': [531], 'protein': [532, 2011, 2077, 2091, 3030, 3330, 3462, 3561, 3880, 4141], 'various': [542], 'forms': [543], 'cellular': [545], 'stress': [546], 'including': [547, 836, 1902, 3688], 'damage.': [549], 'Activation': [550, 944], 'and,': [558, 4094, 4432], 'consequently,': [559, 4095], 'p53-dependent': [560], 'controlled': [563], 'which': [574, 1087, 3071, 3906, 4059], 'includes': [575], 'amino': [576, 582, 1092, 3111, 3116, 3578], 'acids': [577, 3579], '361–382.': [578], 'Post-translational': [579], 'acid': [583, 714, 1853, 3093], 'residues': [584, 1896], 'sequence-specific': [591, 723, 738, 776, 958, 1194, 3270], 'binding.': [593, 725], 'Acetylation': [594], 'lysines': [598], 'p300/CBP/PCAF,': [600], 'recruited': [601], 'distant': [606], 'serines,': [608], 'critically': [609], 'regulates': [610], 'site-specific': [612], 'function': [615, 2578, 2692, 2716, 4035], '(for': [618], 'reviews': [619], 'see': [620], 'Refs.': [621, 1327, 3739], '1Albrechtsen': [622], 'N.': [623], 'Dornreiter': [624], 'I.': [625, 1023], 'Grosse': [626], 'F.': [627], 'Kim': [628], 'E.': [629, 898, 1002, 1585, 1612, 1641, 1643, 1670, 1801, 1803, 1830, 1913, 1967, 2049, 2051, 3006, 3245], 'Wiesmüller': [630], 'L.': [631, 896, 1000, 1064, 1401, 1413, 1583, 1610, 1616, 1647, 1651, 1807, 1811, 2055, 2059, 2100, 2119, 3813, 3825, 4382, 4394], 'Deppert': [632], 'W.': [633], 'Oncogene.': [634, 645], '1999;': [635, 646, 659, 906, 931, 1010, 1392, 1418, 1438, 1593, 2753, 3804, 3830, 3850, 4399], '18:': [636, 647], '7706-7717Crossref': [637], 'PubMed': [638, 649, 667, 700, 763, 822, 876, 909, 939, 992, 1013, 1039, 1074, 1127, 1148, 1231, 1252, 1342, 1354, 1395, 1424, 1441, 1596, 1629, 1660, 1685, 1820, 1845, 1928, 1957, 1982, 2068, 2756, 3021, 3260, 3754, 3766, 3807, 3836, 3853, 4405], 'Scopus': [639, 650, 668, 701, 764, 823, 877, 910, 940, 993, 1014, 1040, 1075, 1128, 1149, 1232, 1253, 1343, 1355, 1396, 1425, 1442, 1597, 1630, 1661, 1686, 1821, 1846, 1929, 1958, 1983, 2069, 2108, 2444, 2609, 2621, 2667, 2680, 2757, 3022, 3261, 3755, 3767, 3808, 3837, 3854, 4406], '(151)': [640], 'Google': [641, 652, 670, 703, 766, 825, 879, 912, 942, 995, 1016, 1042, 1077, 1130, 1151, 1234, 1255, 1345, 1357, 1398, 1427, 1444, 1599, 1632, 1663, 1688, 1823, 1848, 1931, 1960, 1985, 2071, 2110, 2124, 2446, 2611, 2623, 2669, 2682, 2711, 2759, 3024, 3263, 3757, 3769, 3810, 3839, 3856, 4408], 'Scholar,': [642, 653, 913, 996, 1017, 1131, 1235, 1346, 1358, 1399, 1428, 1600, 1633, 1664, 1824, 1961, 2111, 2670, 3758, 3770, 3811, 3840], '2Meek': [643], 'D.W.': [644, 2702], '7666-7675Crossref': [648], '(208)': [651], '3Oren': [654], 'M.': [655, 1025, 1027, 1137, 1241, 1329, 1380, 1672, 1832, 1915, 1969, 2117, 2613, 2672, 2741, 3008, 3247, 3741, 3792], 'J.': [656, 928, 1349, 1384, 1409, 2435, 2440, 2600, 2605, 2658, 2663, 2703, 2745, 3761, 3796, 3821, 4390], 'Biol.': [657, 905, 929, 1009, 1144, 1248, 1417, 1592, 3829, 4398], 'Chem.': [658, 930, 1416, 2616, 2675, 3828, 4397], '274:': [660, 932], '36031-36034Abstract': [661], 'Full': [662, 664, 697, 760, 819, 873, 934, 936, 989, 1071, 1421, 1954, 3833, 4402], 'Text': [663, 665, 698, 761, 820, 874, 935, 937, 990, 1072, 1422, 1955, 3834, 4403], 'PDF': [666, 699, 762, 821, 875, 938, 991, 1073, 1423, 1956, 3835, 4404], '(491)': [669], 'Scholar).': [671, 704, 767, 826, 880, 943, 1043, 1078, 1152, 1256, 1689, 1849, 1932, 2072, 2125, 2447, 2624, 2712, 3857], 'exists': [673], 'vitro': [675, 892], 'form': [679], 'cannot': [681, 3700], 'bind': [682, 885], 'p53-responsive': [684], 'elements': [686], '(4Hupp': [687, 750, 809, 863, 979, 1944], 'T.R.': [688, 751, 810, 864, 980, 1945], 'Sparks': [689, 752, 811, 865, 981, 1946], 'A.': [690, 753, 812, 866, 982, 1123, 1227, 1338, 1362, 1391, 1403, 1625, 1947, 2723, 2752, 3750, 3774, 3803, 3815, 4384], 'Lane': [691, 754, 813, 867, 983, 1948], 'D.P.': [692, 755, 814, 868, 984, 1949], 'Cell.': [693, 756, 815, 869, 904, 985, 1008, 1067, 1143, 1247, 1591, 1950], '1995;': [694, 757, 816, 870, 986, 1068, 1124, 1228, 1351, 1657, 1817, 1951, 2065, 3763], '83:': [695, 758, 817, 871, 987, 1952], '237-245Abstract': [696, 759, 818, 872, 988, 1953], '(448)': [702, 765, 824, 878, 994, 1959], 'Deletion': [705], 'critical': [708], '30-amino': [713], '(CTD)1': [717], 'results': [718, 2946, 4446], 'for': [722, 805, 1486, 2171, 2253, 2459, 2685, 2717, 2792, 2804, 2887, 2905, 3133, 3646, 3899], 'Furthermore,': [726], 'monoclonal': [730], 'antibody': [731, 2955, 2961, 2973, 3056], 'PAb421': [732, 2972, 3055], 'activates': [736], 'triggers': [742], 'transcriptional': [744], 'activity': [745, 978, 3324, 3344, 3482, 3517], 'vivo': [749], 'mechanism': [769, 1262], 'CTD-mediated': [772], 'inhibition': [773], 'understood.': [781], 'intramolecular': [788], 'DNA-binding': [793, 1097], 'core,': [794], 'allosterically': [796], 'locks': [797], 'molecule': [800, 1102, 2383], 'state': [803], 'accordance': [828], 'model,': [831], 'p53(361–382)': [837, 962, 1903, 3062, 3066, 3308, 3375, 3622, 3907], 'can': [838, 884, 3311], 'displace': [839], 'from': [841, 951, 967, 1724, 1749, 1761, 1873, 1886, 2084, 2209, 2225, 2271, 2282, 2306, 2313, 2471, 2964, 2975, 3733, 3903, 4175], 'site': [844, 1098, 2008, 3237, 3408], 'within': [845, 3459], 'central': [847], 'domain,': [848], 'resulting': [849], 'change': [852, 3974], 'conformation': [855], 'isolated': [888, 2150], '(5Selivanova': [893, 1580], 'G.': [894, 998, 1019, 1366, 1581, 1602, 1606, 1614, 1635, 1637, 1649, 1666, 1674, 1795, 1797, 1809, 1826, 1834, 1909, 1917, 1963, 1971, 2043, 2045, 2057, 2096, 2113, 2727, 3002, 3010, 3241, 3249, 3778], 'Ryabchenko': [895, 999, 1582], 'Jansson': [897, 1001, 1367, 1584, 2728, 3779], 'Iotsova': [899, 1003, 1020, 1586, 1667, 1827, 1910, 1964, 3003, 3242], 'V.': [900, 1004, 1021, 1587, 1668, 1828, 1911, 1965, 3004, 3243], 'Wiman': [901, 1005, 1588, 1617, 1652, 1677, 1812, 1837, 1920, 1974, 2060, 3013, 3252], 'K.G.': [902, 1006, 1033, 1589, 1618, 1653, 1678, 1813, 1838, 1921, 1975, 2061, 3014, 3253], 'Mol.': [903, 1007, 1142, 1246, 1590], '19:': [907, 1011, 1594], '3395-3402Crossref': [908, 1012, 1595], '(130)': [911, 1015, 1598], '6Kim': [914], 'A.L.': [915], 'Raffo': [916], 'A.J.': [917, 1116, 1220], 'Brandt-Rauf': [918], 'P.W.': [919], 'Pincus': [920], 'M.R.': [921], 'Monaco': [922], 'R.': [923, 1331, 1348, 1360, 1415, 1434, 2431, 2596, 2615, 2654, 2674, 2721, 3743, 3760, 3772, 3827, 3846, 4396], 'Abarzua': [924], 'P.': [925, 1139, 1141, 1243, 1245, 1364, 1407, 2437, 2602, 2660, 2725, 3776, 3819, 4388], 'Fine': [926], 'R.L.': [927], '34924-34931Abstract': [933], '(111)': [941], 'derived': [950, 966], 'reported': [955], 'be': [957, 3644, 3701, 3909, 4419], 'because': [959, 1049, 3398], 'neither': [960], 'nor': [964], 'demonstrate': [975], 'only': [976], 'weak': [977, 1458, 3719], '5Selivanova': [997], '7Selivanova': [1018], 'Okan': [1022], 'Fritsche': [1024], 'Storm': [1026], 'Groner': [1028], 'B.': [1029, 1114, 1135, 1218, 1239], 'Crafstorm': [1030], 'R.C.': [1031, 1676, 1836, 1919, 1973, 3012, 3251], 'Wilman': [1032], 'Nat.': [1034], 'Med.': [1035], '1997;': [1036, 1145, 1249, 2121], '3:': [1037], '632-638Crossref': [1038], '(318)': [1041], 'shows': [1046, 1203], 'it': [1050, 1493, 1511], 'influence': [1053], 'SRF': [1057], 'GAL4-VP16': [1059], 'proteins': [1060, 1563, 1572, 1765, 2033, 3512, 3545], '(8Jayaraman': [1063], 'Prives': [1065], 'C.': [1066, 1411, 3823, 4392], '81:': [1069], '1021-1029Abstract': [1070], '(353)': [1076], 'overlap': [1080, 1901], 'rich': [1089], 'acids,': [1093], 'second': [1096, 4352], 'key': [1105], 'feature': [1106], 'steric': [1109, 1181, 1543], 'model': [1110, 1154, 1182, 3082], '(9Bayle': [1111, 1215], 'J.H.': [1112, 1216], 'Elenbaas': [1113, 1217], 'Levine': [1115, 1219], 'Proc.': [1117, 1221, 1332, 1385, 1619, 2746, 3744, 3797], 'Natl.': [1118, 1222, 1333, 1386, 1620, 2747, 3745, 3798], 'Acad.': [1119, 1223, 1334, 1387, 1621, 2748, 3746, 3799], 'Sci.': [1120, 1224, 1335, 1388, 1622, 2749, 3747, 3800], 'U.': [1121, 1225, 1336, 1389, 1623, 2750, 3748, 3801], 'S.': [1122, 1226, 1337, 1372, 1378, 1390, 1405, 1624, 2733, 2739, 2751, 3749, 3784, 3790, 3802, 3817, 4386], '92:': [1125, 1229], '5729-5733Crossref': [1126, 1230], '(115)': [1129, 1233], '10Anderson': [1132, 1236], 'M.E.': [1133, 1237], 'Woelker': [1134, 1238], 'Reed': [1136, 1240], 'Wang': [1138, 1242], 'Tegtmeyer': [1140, 1244], '17:': [1146, 1250], '6255-6264Crossref': [1147, 1251], '(105)': [1150, 1254], 'This': [1153, 1535], 'postulates': [1155], 'genomic': [1160], 'gene': [1178], 'promoters.': [1179], 'supported': [1184], 'fact': [1187], 'molecules': [1192, 1464, 1498, 3695, 3980, 4002, 4016, 4025, 4051, 4073, 4083], 'inhibit': [1193, 3450], 'no': [1204, 3158], 'on': [1206, 2151, 2986, 3135, 3320, 3477, 4193], 'deletion': [1209, 1561, 3572], 'To': [1257, 3305, 3453, 3592], 'gain': [1258], 'insight': [1259], 'into': [1260, 4018], 'latency,': [1265], 'were': [1287, 1707, 1732, 1747, 1759, 1766, 1871, 1884, 1905, 2016, 2079, 2207, 2269, 2336, 2497, 2510, 2841, 2901, 2923, 2929, 2947, 2962, 3131, 3198, 3332, 3361, 3483, 3614, 3884, 3936, 3963, 3987, 4121, 4379, 4416, 4441, 4447], 'characterized.': [1288], 'A': [1289, 1866, 3109, 3153, 3184], 'conventional': [1290, 3705], 'used': [1295, 2170, 2463, 2700, 2886, 2924, 3546], 'characterize': [1297], 'whereas': [1302, 3151, 3433], '(FCS)': [1306], 'applied': [1308], 'follow': [1310], 'DNA.': [1319, 3139, 3273], 'sensitivity': [1322], 'FCS': [1324, 2348, 2404, 2904, 3939], '(Fig.1': [1325], '11Eigen': [1328, 3740], 'Rigler': [1330, 1414, 2614, 2673, 3742, 3826, 4395], '1994;': [1339, 1626, 3751], '91:': [1340, 1627, 3752], '5740-5747Crossref': [1341, 3753], '(908)': [1344, 3756], '12Rigler': [1347, 3759], 'Biotechnol.': [1350, 3762], '41:': [1352, 3764], '177-186Crossref': [1353, 3765], '(205)': [1356, 3768], '13Rigler': [1359, 3771], 'Pramanik': [1361, 1402, 2722, 3773, 3814, 4383], 'Jonasson': [1363, 2724, 3775], 'Kratz': [1365, 2726, 3777], 'O.T.': [1368, 2729, 3780], 'Nygren': [1369, 2730, 3781], 'P.-Å.': [1370, 2731, 3782], 'Ståhl': [1371, 2732, 3783], 'Ekberg': [1373, 2734, 3785], 'K.': [1374, 1432, 2735, 3786, 3844], 'Johansson': [1375, 2736, 3787], 'B.-L.': [1376, 2737, 3788], 'Uhlén': [1377, 1379, 2738, 2740, 3789, 3791], 'Jörnvall': [1381, 2742, 3793], 'H.': [1382, 1436, 2743, 3794, 3848], 'Wahren': [1383, 2744, 3795], '96:': [1393, 2754, 3805], '13318-13323Crossref': [1394, 2755, 3806], '(311)': [1397, 2758, 3809], '14Tjernberg': [1400, 3812], 'Björling': [1404, 3816, 4385], 'Thyberg': [1406, 1408, 3818, 3820, 4387, 4389], 'Nordstedt': [1410, 3822, 4391], 'Terenius': [1412, 1615, 1650, 1810, 2058, 2099, 2118, 3824, 4393], '6:': [1419, 3831, 4400], '53-62Abstract': [1420, 3832, 4401], '(139)': [1426, 3838, 4407], '15Wohland': [1429, 3841], 'T.': [1430, 1604, 1639, 1799, 2047, 2098, 2115, 3842], 'Friedrich': [1431, 3843], 'Hovius': [1433, 3845], 'Vogel': [1435, 3847], 'Biochemistry.': [1437, 3849], '38:': [1439, 3851], '8671-8681Crossref': [1440, 3852], '(117)': [1443, 3855], 'Scholar)': [1445, 1986, 2760, 4409], 'allows': [1446, 3715, 4060], 'analysis': [1447, 3717, 4298], 'such': [1449], 'their': [1452, 1745, 1750, 1756, 2272, 3318, 3697, 4096], 'nature': [1453], 'even': [1454], 'they': [1456], 'are': [1457, 2242, 2256, 2651, 4003, 4144, 4280], 'reaction': [1461, 4076, 4119, 4238, 4314], 'mixture.': [1462], 'unexpectedly': [1465], 'presence': [1470, 1989, 2024, 2332, 2852, 3296, 4137, 4307], 'fragment': [1474, 1721, 1854, 3063, 3094, 3914], 'other': [1476, 2858, 3074, 3315, 3434, 4072, 4436], 'peptides.': [1478], 'Our': [1479], 'findings': [1480], 'suggest': [1481], 'when': [1492, 1510, 2918, 3200, 4013, 4023], 'juxtaposed': [1496], 'CTD.': [1507, 3591], 'Thus,': [1508, 3586, 4459], 'prevent': [1516], 'hypothesis': [1536], 'seems': [1537], 'unify': [1539], 'previously': [1541, 2429, 2999], 'postulated': [1542], 'allosteric': [1545], 'models.': [1546], 'plasmid': [1548, 4231], 'encoding': [1549], 'human': [1550, 1856], 'GST-human': [1554], 'fusion': [1558, 1562, 1571, 3511, 3544, 4140], 'protein,': [1559, 3675, 4466], 'GST-p53(1–100),': [1564], 'GST-p53(99–307),': [1565], 'GST-p53(320–393),': [1566], 'GST-p53Δ30,': [1568], 'GST-p53His273': [1573], 'GST-p53Trp248': [1575, 3510], 'have': [1576, 4190], 'described': [1578, 1906, 1942, 2040, 2093, 2428, 3000], 'elsewhere': [1579], '16Bakalkin': [1601], 'Yakovleva': [1603, 1638, 1798, 2046, 2097, 2114], 'Selivanova': [1605, 1636, 1796, 2044], 'Magnusson': [1607, 1644, 1804, 2052], 'K.P.': [1608, 1645, 1805, 2053], 'Szekely': [1609, 1646, 1806, 2054], 'Kiseleva': [1611, 1640, 1669, 1800, 1829, 1912, 1966, 2048, 3005, 3244], 'Klein': [1613, 1648, 1808, 2056], '413-417Crossref': [1628], '(280)': [1631], '17Bakalkin': [1634], 'Kashuba': [1642, 1802, 2050], 'Nucleic': [1654, 1679, 1814, 1839, 1922, 1976, 2062, 3015, 3254], 'Acids': [1655, 1680, 1815, 1840, 1923, 1977, 2063, 3016, 3255], 'Res.': [1656, 1681, 1816, 1841, 1924, 1978, 2064, 2103, 3017, 3256], '23:': [1658, 1818, 2066], '362-369Crossref': [1659, 1819, 2067], '(157)': [1662, 1822, 2070], '18Selivanova': [1665, 1825, 1962], 'Strom': [1671, 1831, 1914, 1968, 3007, 3246], 'Bakalkin': [1673, 1833, 1916, 1970, 3009, 3248], 'Grafstrom': [1675, 1835, 1918, 1972, 3011, 3250], '1996;': [1682, 1842, 1925, 1979, 2105, 3018, 3257], '24:': [1683, 1843, 1926, 1980, 3019, 3258], '3560-3567Crossref': [1684, 1844, 1927, 1981, 3020, 3259], '(65)': [1687, 1847, 1930, 1984, 3023, 3262], 'PG': [1691], 'MG': [1693], '13': [1696], 'copies': [1697, 1702, 2002], '15': [1701, 3550], 'sites,': [1705], 'respectively,': [1706, 4224, 4330], 'obtained': [1708, 1872, 2948, 2963, 4448], 'digestion': [1710], 'PG-CAT': [1713], 'MG-CAT': [1715], 'plasmids': [1716], 'HindIII/EcoRI.': [1718], 'RD': [1720], 'cut': [1723], 'pRC/CMV-Dyn': [1726], 'plasmid.': [1727], 'Plasmid': [1728], 'oligonucleotides': [1731, 2206, 2214, 2268, 2318, 2922, 3653], 'purified': [1733, 1771, 2090, 2179, 3365, 3501], 'Qiagen': [1736], 'kit': [1737], '(Hilden,': [1738], 'Germany)': [1739], 'polyacrylamide-urea': [1741], 'gel': [1742, 1785], 'electrophoresis,': [1743], 'respectively;': [1744], 'concentrations': [1746, 2846, 3699, 4462], 'determined': [1748, 2270], 'absorbance': [1751, 2273, 2289, 2300, 2315, 2342], 'at': [1752, 2274, 2292, 2301, 2319, 2343, 2568, 2843, 2891, 2949, 3170, 3187, 3386, 3488, 3549, 3696, 4449, 4460], '260': [1753, 2275, 2302], 'nm,': [1754], 'extinction': [1757, 2279], 'coefficients': [1758, 2280], 'calculated': [1760, 2281, 2305, 4380], 'nucleotide': [1762, 2283], 'composition.': [1763], 'produced': [1767, 3156], 'Escherichia': [1769], 'coli,': [1770], 'as': [1772, 1791, 1941, 2092, 2328, 2330, 2427, 2925, 3118, 3120, 3547, 3873, 3912, 4225, 4227], 'outlined': [1773], 'earlier,': [1774], 'quantitated': [1776], 'Coomassie': [1778], 'Blue': [1779], 'silver': [1781], 'staining': [1782], 'following': [1783, 2776], 'SDS-polyacrylamide': [1784], 'electrophoresis': [1786], 'bovine': [1788, 3538], 'serum': [1789, 2912, 3539], 'albumin': [1790, 2913], 'standard': [1793, 2353, 2363], '(17Bakalkin': [1794, 2042], '32-amino': [1852, 3092], 'prodynorphin': [1857, 3096, 3098], '(prodynorphin': [1858], '207–238': [1859, 3099], '(BD),': [1863], 'YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT),': [1864], 'dynorphins': [1865, 3152, 3183], '(BD1–17)': [1867], 'B': [1869, 3114, 3155, 3186], '(BD20–32)': [1870], 'Phoenix': [1874], 'Pharmaceuticals': [1875], 'Inc.': [1876, 2978], '(Mountain': [1877], 'View,': [1878], 'CA),': [1879, 2970], 'penta-l-lysine': [1881, 3121, 3169], 'poly-l-lysine': [1883, 3123, 3143], 'purchased': [1885, 2208], 'Bachem': [1887], '(Bubendorf,': [1888], 'Switzerland).': [1889], 'Eight': [1890], '(22-mers)': [1893], 'spanning': [1894, 3606], '337–393': [1897], '14-residue': [1900], '(GSRAHSSHLKSKKGQSTRHKK)': [1904], 'earlier': [1907, 1943, 2041, 2094], '(18Selivanova': [1908, 3001], 'Binding': [1933], 'performed': [1940, 2406, 2930], '2': [1991, 2580, 2844, 2874, 3992, 4130], 'mm': [1992, 2864, 2869, 2872, 2875, 2878], 'MgCl2.': [1993], '1': [1994, 2350, 2359, 2555, 2877, 2906, 3737, 3966, 4201], 'nm32P-labeled': [1995], '30-mer': [1996, 2222], 'BC': [1997, 2221, 3224, 3275], 'containing': [1999, 4216, 4291], 'five': [2000, 4272], 'adjacent': [2001, 2233], 'pentamer': [2006, 2235], 'GST-p53': [2010, 3571, 3926, 4139, 4170], '(35': [2012], 'nm': [2013, 2027, 2276, 2303, 2345, 2351, 2845, 3993, 4131, 4202, 4229], 'monomer)': [2015], 'incubated': [2017, 2842, 3204, 3921], 'absence': [2020, 2849, 3035, 3285], '25': [2026], 'competitor': [2030, 3039, 3288], 'poly(dI-dC).': [2031], '32P-end-labeled': [2037], 'AP-1,': [2073, 3326], 'NF-κB,': [2074, 3327], 'YY1,': [2075, 3328, 3346, 3366, 3467], 'Ku': [2078, 3331], 'assayed': [2080], 'nuclear': [2082, 3335], 'extracts': [2083, 3336], 'SH-SY5Y': [2085, 3338], 'cells': [2086], 'YY1': [2088, 3393, 3425, 3451, 3479, 3502, 3519, 3583, 3629, 3650], '(19Bakalkin': [2095], 'Biochem.': [2101], 'Biophys.': [2102, 2439, 2604, 2662], 'Commun.': [2104], '231:': [2106], '135-139Crossref': [2107], '(11)': [2109], '20Bakalkin': [2112], 'Melzig': [2116], 'Neuroreport.': [2120], '8:': [2122], '2143-2148PubMed': [2123], 'BD': [2126, 3141, 3192, 3219, 3310, 3377, 3871, 3955, 4295], 'Cys-amide': [2130], 'extension': [2131], 'synthesized': [2133], 'labeled': [2135, 2180, 2402, 3731, 3734], 'tetramethylrhodamine-5-iodoacetamide': [2137], '(Molecular': [2138], 'Probes': [2139], 'Europe': [2140], 'BV)': [2141], 'according': [2142, 4410], "manufacturer's": [2145], 'instructions.': [2146], 'Rh-BD': [2148, 2494, 2764, 2769, 2794, 2806, 2815, 2829, 3919, 3979, 4132, 4149, 4241, 4469], 'an': [2152, 2465, 2504, 2513, 2539, 3399, 3997, 4086, 4244], 'analytical': [2153], 'Nucleosil': [2154], '120–3': [2155], 'C18': [2156], 'reverse': [2157], 'phase': [2158], 'HPLC': [2159], 'column': [2160], '(Macherey-Nagel)': [2161], 'lyophilized,': [2163], 'powder': [2166], 'weighed': [2168], 'preparation': [2172], 'solutions.': [2174], 'identity': [2176], 'peptide': [2181, 2193, 2325, 2958, 2984, 3268, 3443], 'confirmed': [2183], 'plasma': [2185], 'desorption': [2186], 'mass': [2187], 'spectrometry.': [2188], 'purity': [2190], '>': [2195], '90%.': [2196], '5-Carboxytetramethylrhodamine': [2197], '(Rh′)-labeled': [2198], '((+)-strands)': [2199], 'unlabeled': [2201, 3223, 3231], '((−)-strands),': [2202], 'HPLC-purified': [2203], '50-mer': [2205], 'TIB-MOLBIOL': [2210], '(Berlin,': [2211], 'Germany).': [2212, 2533], 'represent': [2215], 'oligonucleotides,': [2223, 2327, 2372], 'extended': [2224], '5′': [2226], '3′': [2228], 'ends,': [2229], 'contain': [2231], 'six': [2232], '(mutant': [2240], 'nucleotides': [2241], 'shown': [2243], 'italic': [2245], 'type)': [2246], '(underlined;': [2250], '(+)-strands': [2255], 'shown):': [2257], 'Rh′-5′-AGTCGTCGACCGGGCATGTCCGGGCATGTCCGGGCATGTCCCGTACTAGG-3′': [2258], '(ss-Rh′-SO)': [2259], 'Rh′-5′-AGTCGTCGACCGCGTACTGTGGGCGATCGGCGACACGTCTCCGTACTAGG-3′': [2261], '(ss-Rh′-NO),': [2262], 'respectively.': [2263, 4424], 'Concentrations': [2264, 2322], 'fluorescent': [2266, 2317, 2324, 2369, 2385, 2926, 3875, 4001, 4015, 4092, 4115, 4310], 'using': [2277], 'composition': [2284], 'after': [2285, 2938, 3940, 4453], 'subtraction': [2286], 'wavelength.': [2294], 'Contribution': [2295], 'spectrum': [2308], 'dye': [2311, 2335, 2386, 2393], '546': [2320, 2344], 'nm.': [2321], 'well': [2329, 3119, 4226], 'free': [2334], 'verified': [2337], 'measuring': [2339], 'solution': [2354, 2365], 'prepared': [2355], 'weighing.': [2357], 'At': [2358, 3991], 'nmconcentration': [2360, 3551], 'solutions': [2367, 2395], '0.2': [2373, 2415, 2638, 4369], 'fl': [2374, 2416, 2639], 'confocal': [2375, 2408, 4055], 'volume': [2376, 2412, 2635, 3983, 4020, 4056], 'measurement': [2378, 3985], 'contains': [2379], 'average': [2381, 2540, 2587, 3998], 'one': [2382], 'detected': [2389, 2511], 'FCS.': [2391, 3887], 'Free': [2392], 'exceed': [2398], '10%': [2399], 'fluorescently': [2401, 3730], 'compounds.': [2403], 'illumination': [2409], 'element': [2413, 2636], 'ConfoCor®': [2419], 'instrument': [2420], '(Carl': [2421], 'Zeiss-Evotec,': [2422], 'Jena,': [2423], 'Germany;': [2424], 'Fig.': [2425, 4147, 4206], '1)': [2426], '(21Rigler': [2430, 2595, 2653], 'Mets': [2432, 2597, 2655], 'Ü.': [2433, 2598, 2656], 'Widengren': [2434, 2599, 2657], 'Kask': [2436, 2601, 2659], 'Eur.': [2438, 2603, 2661], '1993;': [2441, 2606, 2664], '22:': [2442, 2607, 2665], '169-175Crossref': [2443, 2608, 2666], '(878)': [2445, 2610, 2668], 'As': [2448, 2998], 'focusing': [2449], 'optics': [2450], 'Zeiss': [2452], 'Neofluar': [2453], '40×': [2454], 'numerical': [2455], 'aperture': [2456], '1.2': [2457], 'objective': [2458], 'water': [2460], 'immersion': [2461], 'epiillumination': [2466], 'setup.': [2467], 'Separation': [2468], 'exciting': [2470], 'emitted': [2472], 'radiation': [2473], 'achieved': [2475], 'dichroic': [2477], '(Omega': [2478, 2488], '540': [2479], 'DRL': [2480], 'PO2;': [2481], 'Omega': [2482], 'Optical,': [2483], 'Blattleboro,': [2484], 'VT)': [2485], 'bandpass': [2487], '565': [2489], 'DR': [2490], '50)': [2491], 'filters.': [2492], 'Rh′-oligonucleotides': [2496], 'excited': [2498, 3957], '514.5-nm': [2501], 'line': [2502], 'argon': [2505], 'laser.': [2506], 'intensity': [2508, 2535, 2546, 2561, 2566, 2576, 2594, 2629, 2714, 3952, 4010, 4033, 4045, 4124, 4255, 4275, 4303], 'fluctuations': [2509, 2562, 2567, 2630, 3947, 3971, 4125, 4153, 4256, 4304], 'avalanche': [2514], 'photodiode': [2515], '(SPCM': [2516], '200;': [2517], 'EG': [2518], '&': [2519], 'G,': [2520], 'Quebec,': [2521], 'Canada)': [2522], 'processed': [2524], 'digital': [2527], 'correlator': [2528], '(ALV': [2529], '5000,': [2530], 'ALV,': [2531], 'Langen,': [2532], 'autocorrelation': [2536, 2577, 2691, 2715, 4034, 4127, 4301], 'functionG(t)': [2537], 'product': [2543], 'between': [2544], 'time': [2549, 2569, 2586, 2791, 2803, 2951, 4049, 4098, 4160, 4196, 4357, 4451], 'shifted': [2550], 'version': [2551], '(Equation': [2552, 4104], '1).': [2553, 3043, 3664, 4169], 'G(t)=〉I(t)I(t+τ)=1T∫0TI(t)I(t+τ)dtorG(t)=〈I〉2+〈∂I(t)∂I(t+τ)〉Equation': [2554], 'Correlation': [2556], 'observed': [2559, 3167, 3385], 'δI(t)': [2563, 2631], 't': [2570], '+': [2571], 'τ': [2572], 'yields': [2573], 'normalized': [2575], 'G(τ).G(τ)=1+〈δI(t)δI(t+τ)〉〈I〉2Equation': [2579], 'where': [2581], 'brackets': [2583], 'describe': [2584], '<I>': [2589], 'describes': [2590], 'mean': [2592], 'Scholar,22Ehrenberg': [2612], 'Phys.': [2617, 2676], '1974;': [2618, 2677], '4:': [2619, 2678], '390-401Crossref': [2620, 2679], '(329)': [2622, 2681], 'our': [2626], 'experiments': [2627], 'occurring': [2632], 'half-axes': [2641], 'ω': [2642], '=': [2643, 2648, 2786, 2798, 4322, 4327, 4338, 4341], '0.25': [2644], 'μm': [2645, 2650], 'z': [2647], '1.25': [2649], '22Ehrenberg': [2671], 'Scholar),': [2683, 3025, 3264], 'calculation': [2686], 'parameters': [2688], 'G(τ)': [2693], 'nonlinear': [2695], 'least': [2696], 'square': [2697], 'minimization': [2698], '(23Marquardt': [2701], 'Soc.': [2704], 'Indust.': [2705], 'Appl.': [2706], 'Math.': [2707], '1963;': [2708], '11:': [2709], '431-441Crossref': [2710], 'three-dimensional': [2718, 4426], 'diffusion': [2719, 2790, 2802, 4048, 4097, 4106, 4159, 4195, 4318, 4356, 4367], '(13Rigler': [2720], 'unbound': [2763, 2805, 2828], 'Rh′-SO': [2766, 2771, 2817, 2831, 2919], 'bound': [2768, 2793, 2814], 'given': [2773], 'equation.G(τ)=1+1N(1−y)11+ττDF11+ωz2ττDF1/2+y11+ττDB11+ωZ2ττDB1/2Equation': [2777], '3': [2778, 2909, 3504, 3631], 'N': [2779], 'number': [2782, 3977], 'molecules,': [2784, 3956], 'τDB': [2785], 'ω2/4DB': [2787], 'Rh′-SO;': [2796, 2808], 'τDF': [2797], 'ω2/4DF': [2799], 'y': [2809], 'fraction': [2812, 2826], 'diffusing': [2818, 2832], 'τDB;': [2820], '(1': [2821, 2914], '−': [2822], 'y)': [2823, 4112], 'τDF.': [2834], 'Fluorescent': [2835], 'probes': [2836], 'Rh-BD,': [2837], 'Rh′-SO,': [2838], 'Rh′-NO': [2840, 2921], 'proteins,': [2855], 'peptides,': [2856], 'compounds': [2859], 'buffer': [2862], '(20': [2863], 'HEPES,': [2865], 'pH': [2866], '7.4,': [2867], '50': [2868], 'KCl,': [2870], '0.1': [2871], 'EDTA,': [2873], 'MgCl2,': [2876], 'dithiothreitol,': [2879], '20%': [2880], 'glycerol,': [2881], '0.05%': [2883], 'Triton': [2884], 'X-100)': [2885], 'studies': [2890], '20': [2892], '°C,': [2893], 'droplets': [2895], '(10': [2896], 'μl)': [2897], 'samples': [2900], 'analyzed': [2902, 3703, 3937], 'up': [2907, 3127, 4270], 'min.': [2910, 3945], 'Bovine': [2911], 'μg/μl)': [2915], 'included': [2917], 'probes.': [2927], 'Measurements': [2928], 'triplicate': [2932], '2–5,': [2933, 3941], '10–20,': [2934, 3942], '30–40': [2936, 3944], 'min': [2937], 'initiation': [2940, 4455], 'reaction.': [2943, 4458], 'Practically': [2944, 4444], 'identical': [2945, 4445], 'points.': [2952], 'Anti-YY1': [2953], 'C20': [2954, 3413, 3437], 'blocking': [2957, 3442], 'anti-p50': [2960], 'Santa': [2965], 'Cruz': [2966], 'Biotechnology': [2967], '(San': [2968], 'Diego,': [2969], 'anti-p53': [2971], 'Oncogene': [2976], 'Science': [2977], '(Unlondale,': [2979], 'NY).': [2980], 'Sequence': [2981], 'effects': [2985, 3134, 3319, 3384, 3469], 'studied': [2992, 3333, 3885], 'assay.': [2997], 'GST-wild': [3027, 3485], 'remained': [3031], 'any': [3037, 3287, 4191], '(Fig.': [3040, 3503, 3630, 3661, 3736, 4154, 4165, 4264, 4343], '2,': [3041, 3662, 4039, 4183], 'lane': [3042, 3633, 3663], 'p53-binding': [3049], 'site,': [3050], 'BC,': [3051], '(lane': [3057, 3064, 3193, 3209, 3226, 3238, 3431], '2),': [3058], '3).': [3065, 4347], 'peptide,': [3070, 3870, 4465], 'suggests': [3072], 'Three': [3081], 'irregular': [3086], 'alternation': [3087], 'residues,': [3090], '(human': [3097], 'BD)': [3101], 'two': [3103, 3355, 4000, 4309], 'constituent': [3106], '(17': [3110], 'acids)': [3112], '(13': [3115], 'acids),': [3117], 'size': [3126], '5': [3129, 3161], 'kDa,': [3130], 'tested': [3132], 'Both': [3140], 'strongly': [3144, 3371, 3627, 4261], '(lanes': [3147, 3160, 3175, 3290, 3299, 3411, 3444, 3520, 3584], '4,': [3148], '15,': [3149, 3302], 'and16),': [3150], 'practically': [3157], '6).': [3163, 3506, 3634], 'No': [3164, 3195], '∼30-fold': [3171], 'higher': [3172, 4274], 'molar': [3173], 'concentration': [3174, 3189, 3491, 3994, 4173], '12': [3176], '13)': [3178], 'mixture': [3181, 3935, 4120, 4239, 4315], 'equimolar': [3190], '7).': [3194], 'stable': [3196], 'seen': [3199], 'radiolabeled': [3201], 'alone': [3208, 3922, 4133], '11': [3210, 3445], 'data': [3212, 4185], 'shown).': [3214, 3359, 3391, 3559], 'Complex': [3215], 'formation': [3216, 3277, 3689, 3724, 4360], 'inhibited': [3221, 3409], '9)': [3227], 'MN': [3233], 'lacking': [3234, 3574], '10;': [3239], 'Ref.18Selivanova': [3240], 'demonstrating': [3265], 'p53-labeled': [3274], 'complex': [3276, 3419, 3430, 3723], '3and': [3291], '4)': [3292], 'poly(dI-dC)': [3298], '8,': [3300], '10,': [3301], '16).': [3304], 'test': [3306], 'whether': [3307, 3455], 'factors': [3314, 4334], 'than': [3316, 4276, 4438], 'cells.': [3339], 'Only': [3340, 3616], 'multifunctional': [3348], 'regulator,': [3350], '(data': [3357, 3389, 3557, 4212, 4233], 'Experiments': [3360], 'repeated': [3362], 'affinity': [3364], '(10–50-fold)': [3372], '(Fig.3': [3378], 'A,': [3379], 'lines': [3380], '1–6)': [3381], 'half-maximum': [3383], '5–10': [3387], 'nmconcentrations': [3388], 'Activated': [3392], 'retained': [3394, 3623], '7–9).': [3412], 'anti-YY1': [3414], 'antibodies': [3415, 3435, 3438], 'supershifted': [3416], 'protein-DNA': [3418], 'p53(361–382),': [3422, 3891], 'showing': [3423], 'present': [3427, 4004], '13),': [3432], 'preincubated': [3439], '12)': [3447], 'failed': [3448, 3552, 3580], 'activation.': [3452], 'determine': [3454], 'segment': [3458, 3638], 'able': [3464], 'domains': [3476, 3568], 'compared.': [3484], 'low': [3490], '(0.7': [3492], 'nm)': [3493], 'substantially': [3494], '(20–50-fold)': [3495], 'stimulated': [3496], 'B,lane': [3505], 'GST-CTD,': [3507], 'GST-p53His273,': [3508], 'enhanced': [3514], '8,10,': [3521], '11).': [3523], 'lower': [3525], 'represented': [3528], 'truncated': [3530], 'YY1-DNA': [3531, 3555], 'complex.': [3532], 'Myoglobin,': [3533], 'casein,': [3534], 'RNase,': [3535], 'polynucleotide': [3536], 'kinase,': [3537], 'albumin,': [3540], 'GST-retinoblastoma,': [3541], 'GST-EBNA5': [3543], 'controls': [3548], 'modify': [3554], 'GST': [3560], 'alone,': [3562], 'GST-p53-N-terminal': [3563], '(NTD),': [3565], '30': [3576], '2–5).': [3585], 'associated': [3589], 'map': [3593], 'closer': [3599], 'details,': [3600], 'eight': [3601], 'partly': [3602], 'overlapping': [3603], '22-mer': [3604], 'most': [3607, 3618], '(residues': [3612], '337–393)': [3613], 'examined.': [3615], 'fragment,': [3621], 'C,': [3632, 4167, 4181, 4345], 'appears': [3642], 'available': [3645], 'intermolecular': [3647, 3722], 'YY1-target': [3652], 'but,': [3654], 'paradoxically,': [3655], 'does': [3656], 'itself': [3660], 'Basic': [3665], 'interacting': [3671, 3694], 'Multiple': [3683], 'peptide-protein': [3684], 'peptide-DNA': [3686, 4289], 'weakly': [3693], 'nanomolar': [3698, 4461], 'readily': [3702], 'biochemical': [3706], 'methods.': [3707], 'FCS,': [3708], 'new': [3710, 4014], 'highly': [3711], 'sensitive': [3712], 'biophysical': [3713], 'technique,': [3714], 'without': [3725], 'preceding': [3726], 'separation': [3727], 'probe': [3732, 3876], 'first': [3860], 'set': [3861], 'experiments,': [3863], 'tetramethyl': [3867, 4293], 'rhodamine-labeled': [3868, 4294], '(Rh-BD)': [3872], 'BD,': [3888], 'chosen': [3893], 'distinguish': [3895], 'relevant': [3898], 'those': [3904], 'involved': [3911], 'molecule.': [3918], 'ds-SO.': [3930], 'Aliquots': [3931], 'incubation': [3934], '(changes)': [3948], 'fluorophore-labeled': [3954], 'focused': [3960], 'laser': [3961], 'beam,': [3962], 'registered': [3964], '(Figs.': [3965], '4': [3968, 4155, 4166, 4180, 4207, 4265, 4344, 4371, 4420], 'A).': [3969], 'reflected': [3972, 4358], 'expressed': [3988], 'kHz.': [3990], 'fluorophore,': [3996], 'volume.': [4007, 4030], 'increased': [4012, 4262], 'diffuse': [4017, 4026], 'decreased': [4022], 'some': [4024], 'out': [4027], 'From': [4031, 4100, 4365], '(EquationsEquation': [4036], '1,': [4037], 'Equation': [4038, 4040], '3)': [4041, 4105], 'fluctuations,': [4046], '(τD)': [4052, 4161], 'determined,': [4058], 'calculations': [4061, 4434], 'molecular': [4064, 4089], 'weight.': [4065], 'Formation': [4066], 'fluorophore': [4070, 4082], 'medium': [4077], 'aggregation': [4079], 'result': [4084], 'increase': [4087, 4245], 'weight': [4090, 4333], '(τD).': [4099], 'function,G(τ)': [4103], 'times': [4107, 4273, 4319, 4368], 'proportions': [4109], '(weight': [4110], 'factors,': [4111], 'different': [4114, 4450], 'components': [4116, 4311], 'evaluated.': [4122], 'Fluorescence': [4123], 'functions': [4128], 'presented': [4145], '4.': [4148], '(control)': [4150], 'exhibited': [4151, 4257], 'typical': [4152], 'A)': [4156], '0.175': [4163, 4323], 'ms': [4164, 4324], 'curve': [4168, 4182, 4346], 'range': [4174], '6': [4176], '37': [4178], 'nm(Fig.': [4179], 'shown)': [4187, 4214], 'Rh-BD.': [4198], 'Addition': [4199], '(ds-SO;': [4205], 'B)': [4208], 'sequences,': [4223], '0.24': [4228], 'shown),': [4235], 'resulted': [4242], 'broadening': [4248], 'fluctuation': [4251], 'peaks.': [4252], 'peaks': [4259], 'heights': [4263], 'B).': [4266], 'peaks,': [4268], 'line,': [4279], 'clear': [4282], 'representation': [4283], 'Brownian': [4286], 'motion': [4287], 'showed': [4305], 'τD1': [4321], 'τD2': [4326], '3899': [4328], 'ms,': [4329], 'corresponding': [4332], '(fractions)': [4335], 'y1': [4337], '0.35': [4339], 'andy2': [4340], '0.65': [4342], 'appearance': [4349], 'component': [4353], 'longer': [4355], 'large': [4362], 'Rh-BD-DNA': [4363], 's,': [4372], 'hydrodynamic': [4374], 'radii': [4375], 'equivalent': [4377], 'spheres': [4378], '(14Tjernberg': [4381], 'Stoke-Einstein': [4413], 'equation': [4414], 'found': [4417], '80': [4422], 'μm,': [4423], 'structure': [4427], 'unclear,': [4431], 'therefore,': [4433], 'assuming': [4435], 'shapes': [4437], 'sphere': [4440], 'performed.': [4443], 'points': [4452], 'w': [4473]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2170965251', 'counts_by_year': [{'year': 2024, 'cited_by_count': 1}, {'year': 2019, 'cited_by_count': 2}, {'year': 2017, 'cited_by_count': 1}, {'year': 2015, 'cited_by_count': 2}], 'updated_date': '2024-12-17T11:22:31.348695', 'created_date': '2016-06-24'}