Publication Information

{'id': 'https://openalex.org/W2098048169', 'doi': 'https://doi.org/10.1074/jbc.m206626200', 'title': 'Inactivation of Human Peroxiredoxin I during Catalysis as the Result of the Oxidation of the Catalytic Site Cysteine to Cysteine-sulfinic Acid', 'display_name': 'Inactivation of Human Peroxiredoxin I during Catalysis as the Result of the Oxidation of the Catalytic Site Cysteine to Cysteine-sulfinic Acid', 'publication_year': 2002, 'publication_date': '2002-10-01', 'ids': {'openalex': 'https://openalex.org/W2098048169', 'doi': 'https://doi.org/10.1074/jbc.m206626200', 'mag': '2098048169', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/12161445'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m206626200', 'pdf_url': 'http://www.jbc.org/article/S0021925818362768/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925818362768/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5021091093', 'display_name': 'Kap‐Seok Yang', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I4210106489', 'display_name': 'National Heart Lung and Blood Institute', 'ror': 'https://ror.org/012pb6c26', 'country_code': 'US', 'type': 'facility', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238', 'https://openalex.org/I4210106489']}, {'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Kap-Seok Yang', 'raw_affiliation_strings': ['Laboratory of Cell Signaling, National Heart, Lung and Blood Institute, National Institutes of Health, Bethesda, Maryland 20892, USA'], 'affiliations': [{'raw_affiliation_string': 'Laboratory of Cell Signaling, National Heart, Lung and Blood Institute, National Institutes of Health, Bethesda, Maryland 20892, USA', 'institution_ids': ['https://openalex.org/I4210106489', 'https://openalex.org/I1299303238']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5101539185', 'display_name': 'Sang Won Kang', 'orcid': 'https://orcid.org/0000-0001-6446-163X'}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Sang Won Kang', 'raw_affiliation_strings': ['From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5016556468', 'display_name': 'Hyun Ae Woo', 'orcid': 'https://orcid.org/0000-0002-3483-1203'}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Hyun Ae Woo', 'raw_affiliation_strings': ['From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5019669717', 'display_name': 'Sung Chul Hwang', 'orcid': 'https://orcid.org/0000-0003-2401-619X'}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Sung Chul Hwang', 'raw_affiliation_strings': ['From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5111909391', 'display_name': 'Ho Zoon Chae', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Ho Zoon Chae', 'raw_affiliation_strings': ['From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5004733486', 'display_name': 'Kanghwa Kim', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Kanghwa Kim', 'raw_affiliation_strings': ['From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5020834497', 'display_name': 'Sue Goo Rhee', 'orcid': 'https://orcid.org/0000-0002-4740-4956'}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Sue Goo Rhee', 'raw_affiliation_strings': ['From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Cell Signaling,  NHLBI, National Institutes of Health, Bethesda,\u2009Maryland\u200920892', 'institution_ids': ['https://openalex.org/I1299303238']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 6.438, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 449, 'citation_normalized_percentile': {'value': 0.999975, 'is_in_top_1_percent': True, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 99, 'max': 100}, 'biblio': {'volume': '277', 'issue': '41', 'first_page': '38029', 'last_page': '38036'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T11884', 'display_name': 'Redox biology and oxidative stress', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T11884', 'display_name': 'Redox biology and oxidative stress', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11481', 'display_name': 'Sulfur Compounds in Biology', 'score': 0.9984, 'subfield': {'id': 'https://openalex.org/subfields/1303', 'display_name': 'Biochemistry'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T10934', 'display_name': 'Heat shock proteins research', 'score': 0.9954, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/peroxiredoxin', 'display_name': 'Peroxiredoxin', 'score': 0.8180915}, {'id': 'https://openalex.org/keywords/dithiothreitol', 'display_name': 'Dithiothreitol', 'score': 0.67443085}, {'id': 'https://openalex.org/keywords/thiol', 'display_name': 'Thiol', 'score': 0.6005011}, {'id': 'https://openalex.org/keywords/catalytic-cycle', 'display_name': 'Catalytic cycle', 'score': 0.58999527}, {'id': 'https://openalex.org/keywords/sulfenic-acid', 'display_name': 'Sulfenic acid', 'score': 0.52253413}], 'concepts': [{'id': 'https://openalex.org/C2780416994', 'wikidata': 'https://www.wikidata.org/wiki/Q419462', 'display_name': 'Peroxiredoxin', 'level': 4, 'score': 0.8180915}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.80147135}, {'id': 'https://openalex.org/C2777737464', 'wikidata': 'https://www.wikidata.org/wiki/Q2540636', 'display_name': 'Thioredoxin reductase', 'level': 4, 'score': 0.75275433}, {'id': 'https://openalex.org/C3623737', 'wikidata': 'https://www.wikidata.org/wiki/Q421219', 'display_name': 'Thioredoxin', 'level': 3, 'score': 0.70288014}, {'id': 'https://openalex.org/C2779201268', 'wikidata': 'https://www.wikidata.org/wiki/Q186474', 'display_name': 'Cysteine', 'level': 3, 'score': 0.7026785}, {'id': 'https://openalex.org/C2777824588', 'wikidata': 'https://www.wikidata.org/wiki/Q414783', 'display_name': 'Dithiothreitol', 'level': 3, 'score': 0.67443085}, {'id': 'https://openalex.org/C161790260', 'wikidata': 'https://www.wikidata.org/wiki/Q82264', 'display_name': 'Catalysis', 'level': 2, 'score': 0.6283232}, {'id': 'https://openalex.org/C2781324293', 'wikidata': 'https://www.wikidata.org/wiki/Q220410', 'display_name': 'Thiol', 'level': 2, 'score': 0.6005011}, {'id': 'https://openalex.org/C63338738', 'wikidata': 'https://www.wikidata.org/wiki/Q287862', 'display_name': 'Catalytic cycle', 'level': 3, 'score': 0.58999527}, {'id': 'https://openalex.org/C2780158455', 'wikidata': 'https://www.wikidata.org/wiki/Q411721', 'display_name': 'Sulfenic acid', 'level': 4, 'score': 0.52253413}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.4439891}, {'id': 'https://openalex.org/C181199279', 'wikidata': 'https://www.wikidata.org/wiki/Q8047', 'display_name': 'Enzyme', 'level': 2, 'score': 0.3390931}, {'id': 'https://openalex.org/C162008176', 'wikidata': 'https://www.wikidata.org/wiki/Q419305', 'display_name': 'Peroxidase', 'level': 3, 'score': 0.22321367}], 'mesh': [{'descriptor_ui': 'D020134', 'descriptor_name': 'Catalytic Domain', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': True}, {'descriptor_ui': 'D003545', 'descriptor_name': 'Cysteine', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D003545', 'descriptor_name': 'Cysteine', 'qualifier_ui': 'Q000031', 'qualifier_name': 'analogs & derivatives', 'is_major_topic': True}, {'descriptor_ui': 'D009249', 'descriptor_name': 'NADP', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D010544', 'descriptor_name': 'Peroxidases', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000975', 'descriptor_name': 'Antioxidants', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000975', 'descriptor_name': 'Antioxidants', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D000975', 'descriptor_name': 'Antioxidants', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D002384', 'descriptor_name': 'Catalysis', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D003545', 'descriptor_name': 'Cysteine', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D003545', 'descriptor_name': 'Cysteine', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D006367', 'descriptor_name': 'HeLa Cells', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006801', 'descriptor_name': 'Humans', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006861', 'descriptor_name': 'Hydrogen Peroxide', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006861', 'descriptor_name': 'Hydrogen Peroxide', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D006863', 'descriptor_name': 'Hydrogen-Ion Concentration', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009154', 'descriptor_name': 'Mutation', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009249', 'descriptor_name': 'NADP', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D016877', 'descriptor_name': 'Oxidants', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D016877', 'descriptor_name': 'Oxidants', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D010084', 'descriptor_name': 'Oxidation-Reduction', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D010544', 'descriptor_name': 'Peroxidases', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010544', 'descriptor_name': 'Peroxidases', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D010544', 'descriptor_name': 'Peroxidases', 'qualifier_ui': 'Q000235', 'qualifier_name': 'genetics', 'is_major_topic': False}, {'descriptor_ui': 'D054464', 'descriptor_name': 'Peroxiredoxins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000235', 'qualifier_name': 'genetics', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D021241', 'descriptor_name': 'Spectrometry, Mass, Electrospray Ionization', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D019032', 'descriptor_name': 'Spectrometry, Mass, Matrix-Assisted Laser Desorption-Ionization', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013880', 'descriptor_name': 'Thioredoxin-Disulfide Reductase', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013880', 'descriptor_name': 'Thioredoxin-Disulfide Reductase', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D013879', 'descriptor_name': 'Thioredoxins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013879', 'descriptor_name': 'Thioredoxins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m206626200', 'pdf_url': 'http://www.jbc.org/article/S0021925818362768/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/12161445', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m206626200', 'pdf_url': 'http://www.jbc.org/article/S0021925818362768/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [{'display_name': 'Life on land', 'id': 'https://metadata.un.org/sdg/15', 'score': 0.44}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 45, 'referenced_works': ['https://openalex.org/W1270671049', 'https://openalex.org/W1483721839', 'https://openalex.org/W1484322088', 'https://openalex.org/W1543602354', 'https://openalex.org/W1578809256', 'https://openalex.org/W1588367297', 'https://openalex.org/W1589043152', 'https://openalex.org/W1595716614', 'https://openalex.org/W1604304380', 'https://openalex.org/W1965525795', 'https://openalex.org/W1967099953', 'https://openalex.org/W1968943030', 'https://openalex.org/W1970519591', 'https://openalex.org/W1970719398', 'https://openalex.org/W1972210398', 'https://openalex.org/W1973129732', 'https://openalex.org/W1974838532', 'https://openalex.org/W1975276394', 'https://openalex.org/W1979803581', 'https://openalex.org/W1992334809', 'https://openalex.org/W1993055408', 'https://openalex.org/W1998792067', 'https://openalex.org/W2007684558', 'https://openalex.org/W2008203769', 'https://openalex.org/W2016241657', 'https://openalex.org/W2017265125', 'https://openalex.org/W2019732586', 'https://openalex.org/W2021410510', 'https://openalex.org/W2037571897', 'https://openalex.org/W2040224411', 'https://openalex.org/W2042698393', 'https://openalex.org/W2051687003', 'https://openalex.org/W2055979989', 'https://openalex.org/W2059129711', 'https://openalex.org/W2066011802', 'https://openalex.org/W2069480316', 'https://openalex.org/W2075124697', 'https://openalex.org/W2079557671', 'https://openalex.org/W2081748849', 'https://openalex.org/W2092463196', 'https://openalex.org/W2094812249', 'https://openalex.org/W2117937845', 'https://openalex.org/W2129504476', 'https://openalex.org/W2150269465', 'https://openalex.org/W2473226389'], 'related_works': ['https://openalex.org/W4390024084', 'https://openalex.org/W3142756238', 'https://openalex.org/W2329562599', 'https://openalex.org/W2120473234', 'https://openalex.org/W2077016287', 'https://openalex.org/W2069480316', 'https://openalex.org/W2044075759', 'https://openalex.org/W2001735644', 'https://openalex.org/W1973141315', 'https://openalex.org/W1604304380'], 'abstract_inverted_index': {'By': [0, 199], 'following': [1, 200, 2796, 3020], 'peroxiredoxin': [2, 201, 398, 513], 'I': [3, 13, 30, 128, 141, 156, 173, 189, 202, 212, 229, 327, 340, 355, 372, 388, 871, 2031, 2071, 2133, 2168, 2392, 2757, 3016, 3148, 3218, 3308, 3324, 3422, 3447, 3479, 3529, 3974, 3990, 4006, 4044, 4366, 4429], '(Prx': [4, 203, 717, 848], 'I)-dependent': [5, 204], 'NADPH': [6, 205, 1215, 2345, 3030, 3048, 3131, 3138, 3161, 4398, 4412, 4487], 'oxidation': [7, 60, 81, 100, 206, 259, 280, 299, 1421, 1878, 2346, 3028, 3049, 3132, 3139, 3162, 3971, 4075, 4333, 4399, 4413], 'spectrophotometrically,': [8, 207], 'we': [9, 208, 1882, 2076, 2105], 'observed': [10, 209, 1871, 2106, 3222, 3294, 4151, 4183], 'that': [11, 51, 121, 171, 210, 250, 320, 370, 429, 711, 864, 1134, 1656, 1802, 1810, 1884, 1914, 2043, 2078, 2107, 2204, 3157, 3238, 3286, 3969, 4062, 4171, 4332], 'Prx': [12, 29, 127, 140, 155, 172, 188, 211, 228, 326, 339, 354, 371, 387, 782, 795, 844, 870, 967, 986, 1056, 1129, 1209, 1224, 1237, 1310, 1398, 1402, 1653, 1885, 2030, 2033, 2055, 2070, 2087, 2110, 2132, 2167, 2391, 2615, 2637, 2756, 3015, 3147, 3217, 3307, 3323, 3421, 3446, 3478, 3518, 3528, 3973, 3989, 4005, 4043, 4245, 4341, 4365, 4428], 'activity': [14, 22, 213, 221, 1207, 3012, 4288, 4395], 'decreased': [15, 214, 2040, 3101, 3160], 'gradually': [16, 215, 4440], 'with': [17, 25, 47, 197, 216, 224, 246, 396, 441, 701, 981, 1073, 1939, 2039, 2192, 2237, 2254, 2371, 2435, 2458, 2472, 2520, 2608, 2633, 2643, 2661, 2679, 2699, 2714, 2925, 2940, 2972, 3102, 3277, 3283, 3403, 3456, 3794, 3837, 3905, 3993, 4010, 4138, 4168, 4242, 4320, 4371, 4441, 4468], 'time.': [18, 217], 'The': [19, 90, 218, 289, 511, 841, 966, 1646, 1792, 1806, 1829, 2123, 2214, 2322, 2380, 2442, 2866, 2961, 3010, 3044, 3115, 3269, 3356, 3370, 3393, 3410, 3469, 3890, 3908, 3932, 4079, 4123, 4322, 4451], 'decay': [20, 219], 'in': [21, 54, 131, 158, 193, 220, 253, 330, 357, 392, 722, 793, 797, 860, 868, 979, 998, 1133, 1415, 1662, 1972, 2007, 2050, 2060, 2093, 2114, 2170, 2247, 2268, 2312, 2426, 2478, 2492, 2769, 2932, 2948, 2965, 3031, 3292, 3330, 3400, 3432, 3450, 3570, 3848, 3900, 4152, 4247, 4289, 4314, 4344, 4433], 'was': [23, 56, 95, 118, 174, 190, 222, 255, 294, 317, 373, 389, 696, 2287, 2353, 2382, 2589, 2631, 2751, 2853, 2871, 2913, 3017, 3056, 3149, 3164, 3221, 3235, 3260, 3325, 3399, 3601, 3875, 3991, 4007, 4173, 4182, 4234, 4253, 4367, 4386, 4414, 4488], 'coincident': [24, 223], 'the': [26, 62, 106, 132, 159, 225, 261, 305, 331, 358, 442, 798, 802, 861, 999, 1058, 1076, 1125, 1201, 1205, 1235, 1298, 1305, 1404, 1409, 1527, 1657, 1668, 1674, 1811, 1825, 1866, 1870, 1874, 1919, 1924, 1967, 1973, 2018, 2066, 2079, 2096, 2099, 2115, 2195, 2206, 2222, 2276, 2279, 2305, 2349, 2387, 2410, 2568, 2574, 2582, 2586, 2601, 2629, 2719, 2795, 2828, 2845, 2850, 2863, 2910, 2966, 3021, 3027, 3099, 3105, 3107, 3109, 3111, 3128, 3137, 3153, 3158, 3191, 3240, 3254, 3257, 3263, 3266, 3273, 3278, 3284, 3287, 3304, 3316, 3320, 3331, 3348, 3360, 3382, 3396, 3404, 3417, 3425, 3433, 3438, 3442, 3459, 3474, 3496, 3508, 3523, 3542, 3547, 3555, 3573, 3606, 3609, 3648, 3658, 3669, 3673, 3703, 3708, 3855, 3859, 3864, 3878, 3881, 3888, 3896, 3906, 3925, 3955, 3965, 4015, 4063, 4070, 4073, 4116, 4156, 4162, 4216, 4228, 4249, 4290, 4293, 4315, 4345, 4352, 4355, 4362, 4383, 4408, 4434, 4460, 4469, 4491], 'conversion': [27, 226, 2097, 3305], 'of': [28, 61, 92, 101, 108, 137, 154, 161, 168, 179, 187, 227, 260, 291, 300, 307, 336, 353, 360, 367, 378, 386, 427, 444, 481, 693, 709, 801, 843, 850, 884, 985, 1014, 1075, 1124, 1128, 1208, 1300, 1308, 1411, 1649, 1673, 1873, 1923, 2017, 2027, 2068, 2086, 2098, 2125, 2250, 2264, 2278, 2295, 2351, 2386, 2390, 2413, 2449, 2505, 2523, 2567, 2614, 2724, 2755, 2762, 2830, 2842, 2862, 2904, 2909, 2992, 3008, 3013, 3029, 3042, 3047, 3058, 3113, 3119, 3130, 3136, 3146, 3169, 3211, 3216, 3239, 3256, 3265, 3272, 3306, 3333, 3359, 3377, 3381, 3395, 3407, 3412, 3427, 3440, 3473, 3510, 3517, 3598, 3653, 3686, 3767, 3773, 3788, 3815, 3831, 3857, 3863, 3880, 3887, 3895, 3924, 3957, 3964, 3972, 4041, 4065, 4072, 4076, 4081, 4292, 4317, 4334, 4354, 4378, 4382, 4411, 4418, 4423, 4436, 4454], 'to': [31, 58, 66, 77, 82, 98, 103, 230, 257, 265, 276, 281, 297, 302, 436, 516, 791, 866, 1066, 1079, 1429, 1525, 1877, 1932, 2004, 2020, 2095, 2102, 2120, 2210, 2225, 2261, 2348, 2393, 2423, 2446, 2497, 2581, 2624, 2636, 2826, 2856, 3026, 3151, 3167, 3172, 3196, 3207, 3237, 3303, 3309, 3514, 3522, 3657, 3760, 3982, 4028, 4033, 4045, 4083, 4114, 4130, 4161, 4175, 4237, 4255, 4336, 4401, 4420], 'a': [32, 148, 162, 177, 231, 347, 361, 376, 425, 520, 593, 690, 707, 785, 982, 1301, 1416, 1431, 1663, 2025, 2126, 2201, 2269, 2292, 2359, 2364, 2372, 2377, 2394, 2447, 2493, 2625, 2662, 2680, 2700, 2715, 2782, 2902, 2916, 2926, 2958, 3032, 3204, 3208, 3230, 3245, 3310, 3689, 3692, 3746, 3849, 3983, 4139, 4243, 4304, 4318, 4465], 'more': [33, 232, 1833, 3124, 3246, 3311, 4163], 'acidic': [34, 233, 2054, 2084, 3247, 3258, 3274, 3312, 3321, 4164], 'species': [35, 234, 3275], 'as': [36, 71, 235, 270, 1320, 2194, 2327, 2358, 2873, 3001, 4227], 'assessed': [37, 236], 'by': [38, 88, 237, 287, 448, 1064, 1139, 1144, 1233, 1241, 1315, 1327, 1667, 1817, 1836, 1879, 1930, 1966, 2073, 2178, 2187, 2289, 2309, 2384, 2456, 2490, 2508, 2585, 2606, 2832, 3019, 3126, 3351, 3365, 3464, 3505, 3603, 3683, 3696, 3721, 3758, 4111, 4198, 4211, 4215, 4281, 4327, 4369, 4396, 4458], 'two-dimensional': [39, 238, 2002, 2089, 2619, 2657, 3197, 4131], 'gel': [40, 239], 'electrophoresis.': [41, 240], 'Mass': [42, 241, 2906, 3961], 'spectral': [43, 242, 3962], 'analysis': [44, 153, 243, 352, 2754, 2761, 2841, 2908, 3963, 4133], 'and': [45, 116, 244, 315, 433, 438, 483, 592, 698, 704, 719, 886, 1016, 1220, 1247, 1323, 1651, 1670, 2014, 2032, 2082, 2173, 2182, 2197, 2228, 2258, 2315, 2376, 2409, 2416, 2454, 2476, 2485, 2539, 2543, 2562, 2565, 2600, 2628, 2648, 2713, 2733, 2759, 2772, 2814, 2824, 2897, 2935, 2952, 2955, 2996, 3039, 3104, 3187, 3190, 3289, 3297, 3337, 3342, 3374, 3384, 3389, 3419, 3444, 3458, 3476, 3487, 3498, 3503, 3526, 3538, 3544, 3565, 3586, 3592, 3622, 3633, 3640, 3678, 3691, 3715, 3735, 3762, 3915, 3930, 3937, 3946, 3949, 4106, 4118, 4125, 4135, 4147, 4221, 4375, 4391, 4438], 'studies': [46, 245], 'Cys': [48, 247, 787, 858, 972, 1229, 2209, 4252], 'mutants': [49, 248, 2169], 'determined': [50, 249, 3876], 'this': [52, 251, 1480, 3120], 'shift': [53, 252, 2085, 4181], 'pI': [55, 254, 3209, 3215], 'due': [57, 256, 2092], 'selective': [59, 258], 'catalytic': [63, 110, 133, 262, 309, 332, 1658, 2116, 4346, 4363], 'site': [64, 263, 1410, 3439, 3583, 3630], 'Cys51-SH': [65, 264, 4172, 4335], 'Cys51-SO2H.': [67, 104, 266, 303], 'Thus,': [68, 267, 1200], 'Cys51-SOH': [69, 268], 'generated': [70, 269, 2186], 'an': [72, 271, 855, 1081, 2301, 2556, 2595, 2674], 'intermediate': [73, 272, 1127, 1483, 1926], 'during': [74, 273, 1892], 'catalysis': [75, 274, 1893, 4300], 'appeared': [76, 275, 3243], 'undergo': [78, 277, 4202], 'occasional': [79, 278], 'further': [80, 279, 1928, 4349], 'Cys51-SO2H,': [83, 282, 3858, 3978], 'which': [84, 283, 789, 991, 1070, 1243, 1823, 2171, 3920, 4187, 4248], 'cannot': [85, 284, 1478, 1963], 'be': [86, 285, 517, 1137, 1313, 1526, 1964], 'reversed': [87, 286], 'thioredoxin.': [89, 288], 'presence': [91, 107, 160, 290, 306, 359, 3332, 3426, 3956, 4291], 'H2O2': [93, 169, 292, 368, 1065, 1931, 2352, 3059, 3116, 3336, 3759, 4047, 4402], 'alone': [94, 293], 'not': [96, 143, 295, 342, 1143, 1326, 2058, 3165, 3176, 3751, 4019, 4036, 4051, 4057, 4201, 4297], 'sufficient': [97, 296], 'cause': [99, 298], 'Cys51': [102, 301, 792, 2172, 3525, 3929, 3975], 'Rather,': [105, 304], 'complete': [109, 308, 2460], 'components': [111, 310], '(H2O2,': [112, 311], 'thioredoxin,': [113, 312], 'thioredoxin': [114, 313, 399, 400, 1140, 1217], 'reductase,': [115, 314], 'NADPH)': [117, 316], 'necessary,': [119, 318], 'indicating': [120, 319, 3156], 'such': [122, 321, 1319, 1915, 2044, 3512, 4180], 'hyperoxidation': [123, 136, 322, 335], 'occurs': [124, 323, 1917, 4338], 'only': [125, 144, 324, 343, 993, 2108, 3996, 4339], 'when': [126, 325, 4003, 4206, 4279, 4340], 'is': [129, 328, 1062, 1131, 1239, 1407, 1424, 1660, 1795, 1815, 1832, 1889, 1927, 3122, 3219, 3281, 3756, 3898, 4069, 4188, 4193, 4276, 4301, 4324, 4342, 4456], 'engaged': [130, 329, 2113, 4343], 'cycle.': [134, 333, 4347], 'Likewise,': [135, 334], 'Cys172/Ser172': [138, 337], 'mutant': [139, 338, 4120, 4126, 4246], 'required': [142, 341, 4194], 'H2O2,': [145, 344, 2414, 4144, 4169, 4372], 'but': [146, 345, 1142, 1325, 1413, 1530, 3750, 3979], 'also': [147, 191, 346, 390, 1408, 1808, 2048, 3568, 3980], 'catalysis-supporting': [149, 348], 'thiol': [150, 349, 1317, 1841, 4307], '(dithiothreitol).': [151, 350], 'Kinetic': [152, 351], 'inactivation': [157, 356, 1916, 2046, 2072, 2081, 4419, 4425, 4430, 4455, 4470, 4477], 'low': [163, 362], 'steady-state': [164, 363], 'level': [165, 364], '(<1': [166, 365], 'μm)': [167, 366], 'indicated': [170, 369, 2388, 2411], 'hyperoxidized': [175, 374, 3757, 4174, 4225, 4356], 'at': [176, 183, 375, 382, 2243, 2281, 2291, 2317, 2355, 2510, 2696, 2778, 2791, 3052, 3060, 3184, 3203, 3223, 3244, 3262, 3295, 3535, 3558, 3584, 3590, 3620, 3631, 3637, 3675, 3712, 3789, 3832, 3959, 4388, 4447, 4479], 'rate': [178, 377, 3046, 3100, 3112, 3129, 3163, 3293, 4410], '0.072%': [180, 379], 'per': [181, 380], 'turnover': [182, 381], '30': [184, 383, 2356, 2501, 2514, 2731, 2736], '°C.': [185, 384], 'Hyperoxidation': [186, 385], 'detected': [192, 391, 2642], 'HeLa': [194, 393, 2418, 2465], 'cells': [195, 394, 2012, 2019, 2233, 2306, 2420, 2443, 2467], 'treated': [196, 395], 'H2O2.': [198, 397, 2021, 2074, 3043], 'reductase': [401, 598, 1218], 'dithiothreitol': [402, 1321], '3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonic': [403], 'acid': [404, 1068, 1418, 1821, 1921, 1934, 1962, 2709, 2775, 2944, 2951, 3764, 3861, 4054, 4067], 'high': [405], 'performance': [406], 'liquid': [407, 2313], 'chromatography': [408], 'electrospray': [409, 2747], 'ionization': [410, 419], 'mass': [411, 414, 421, 2749, 2851, 2894, 3005, 3394, 3406, 3414, 3698, 3723, 3933], 'spectrometry': [412, 415, 422, 2907], 'tandem': [413], 'matrix-assisted': [416], 'laser': [417], 'desorption': [418], 'time-of-flight': [420], 'Peroxiredoxins': [423], 'are': [424, 974, 1211, 1231, 2091, 2118, 3301, 3912], 'family': [426, 708], 'peroxidases': [428, 710], 'reduce': [430, 1479], 'hydrogen': [431], 'peroxide': [432, 3970], 'alkyl': [434], 'hydroperoxides': [435], 'water': [437], 'alcohol,': [439], 'respectively,': [440, 3300], 'use': [443], 'reducing': [445, 1202, 4207], 'equivalents': [446, 1203, 4208], 'provided': [447, 4210], 'thiol-containing': [449], 'proteins': [450, 515, 783, 987, 2006, 2028, 2324, 2617, 2758, 2831, 3362, 3500], '(1Chae': [451, 1084, 1329, 1894, 1943, 4257], 'H.Z.': [452, 573, 663, 745, 772, 805, 832, 1028, 1085, 1103, 1151, 1179, 1251, 1330, 1348, 1371, 1895, 1944, 2141, 2330, 3072, 4258], 'Chung': [453, 1086, 1331, 1896, 1945, 4259], 'S.J.': [454, 1087, 1332, 1897, 1946, 4260], 'Rhee': [455, 535, 555, 578, 672, 754, 773, 814, 833, 948, 1037, 1088, 1106, 1158, 1180, 1260, 1333, 1351, 1378, 1438, 1462, 1488, 1539, 1683, 1852, 1898, 1947, 2148, 2333, 3077, 4261], 'S.G.': [456, 470, 536, 556, 579, 673, 755, 774, 815, 834, 873, 949, 1003, 1038, 1089, 1107, 1159, 1181, 1261, 1334, 1352, 1379, 1439, 1463, 1489, 1540, 1684, 1853, 1899, 1948, 2149, 2334, 3078, 4262], 'J.': [457, 539, 580, 607, 630, 650, 921, 950, 1090, 1160, 1184, 1285, 1335, 1380, 1440, 1490, 1509, 1513, 1541, 1560, 1564, 1582, 1602, 1764, 1900, 1949, 2150, 4092, 4263], 'Biol.': [458, 500, 540, 581, 609, 651, 733, 903, 951, 1091, 1161, 1185, 1286, 1336, 1381, 1441, 1468, 1491, 1542, 1583, 1603, 1636, 1689, 1766, 1901, 1950, 1991, 2151, 4093, 4264], 'Chem.': [459, 501, 541, 582, 652, 734, 904, 952, 1092, 1162, 1186, 1287, 1337, 1382, 1442, 1492, 1543, 1584, 1604, 1902, 1951, 2152, 4094, 4265], '1994;': [460, 681, 763, 776, 823, 836, 1046, 1093, 1115, 1269, 1338, 1360, 1903, 1952, 4266], '269:': [461, 1094, 1339, 1904, 1953, 4267], '27670-27678Abstract': [462, 1095, 1340, 1905, 1954, 4268], 'Full': [463, 545, 586, 656, 956, 958, 1096, 1166, 1168, 1190, 1192, 1291, 1341, 1386, 1388, 1446, 1448, 1496, 1498, 1547, 1549, 1588, 1590, 1608, 1610, 1745, 1747, 1906, 1955, 2156, 2158, 3086, 3088, 4098, 4269], 'Text': [464, 546, 587, 657, 957, 959, 1097, 1167, 1169, 1191, 1193, 1292, 1342, 1387, 1389, 1447, 1449, 1497, 1499, 1548, 1550, 1589, 1591, 1609, 1611, 1746, 1748, 1907, 1956, 2157, 2159, 3087, 3089, 4099, 4270], 'PDF': [465, 547, 588, 658, 960, 1098, 1170, 1194, 1293, 1343, 1390, 1450, 1500, 1551, 1592, 1612, 1749, 1908, 1957, 2160, 3090, 4100, 4271], 'PubMed': [466, 506, 548, 567, 589, 613, 635, 659, 684, 739, 766, 826, 909, 933, 961, 1049, 1099, 1118, 1171, 1195, 1272, 1294, 1344, 1363, 1391, 1451, 1472, 1501, 1518, 1552, 1569, 1593, 1613, 1641, 1693, 1722, 1770, 1787, 1859, 1909, 1958, 1996, 2161, 2340, 3091, 4101, 4272], 'Google': [467, 492, 509, 549, 570, 590, 616, 638, 660, 687, 742, 769, 779, 829, 839, 895, 912, 936, 964, 1025, 1052, 1100, 1121, 1174, 1198, 1275, 1295, 1345, 1366, 1394, 1454, 1475, 1504, 1519, 1555, 1570, 1596, 1616, 1644, 1696, 1725, 1752, 1773, 1790, 1862, 1910, 1959, 1999, 2164, 2343, 3094, 4102, 4273], 'Scholar,': [468, 493, 550, 571, 617, 639, 661, 743, 770, 830, 896, 913, 937, 1026, 1101, 1175, 1276, 1346, 1367, 1455, 1505, 1556, 1571, 1597, 1617, 1697, 1726, 1753, 1774], '2Rhee': [469], 'Kang': [471, 874, 940, 1004, 1458, 1679, 2331, 3075], 'S.W.': [472, 875, 941, 1005, 1149, 1369, 1435, 1459, 1485, 1536, 1680, 2139, 2332, 3076], 'Chang': [473, 876, 1006], 'T.S.': [474, 877, 1007], 'Jeong': [475, 878, 1008], 'W.': [476, 879, 1009], 'Kim': [477, 531, 553, 574, 576, 880, 942, 1010, 1154, 1374, 2144, 3073], 'K.': [478, 530, 554, 577, 665, 747, 807, 881, 943, 1011, 1030, 1155, 1253, 1375, 1703, 1984, 2145], 'International': [479, 882, 1012], 'Union': [480, 883, 1013], 'Biochemistry': [482, 885, 1015], 'Molecular': [484, 887, 1017, 2663], 'Biology': [485, 888, 1018], 'Life.': [486, 889, 1019], '2001;': [487, 890, 1020, 1515, 1566, 1993], '52:': [488, 891, 1021], '35-41Crossref': [489, 892, 1022], 'Scopus': [490, 507, 568, 614, 636, 685, 740, 767, 827, 893, 910, 934, 962, 1023, 1050, 1119, 1172, 1196, 1273, 1364, 1392, 1452, 1473, 1502, 1553, 1594, 1614, 1642, 1694, 1723, 1750, 1771, 1788, 1860, 1997, 2162, 2341, 3092], '(512)': [491, 894, 1024], '3Hofmann': [494, 897], 'B.': [495, 728, 898], 'Hecht': [496, 729, 899], 'H.J.': [497, 730, 900, 1457, 1678, 3074], 'Flohé': [498, 731, 901], 'L.': [499, 732, 902], 'Hoppe-Seyler.': [502, 735, 905], '2002;': [503, 736, 906, 1784], '383:': [504, 737, 907], '347-364Crossref': [505, 738, 908], '(768)': [508, 741, 911], 'Scholar).': [510, 688, 780, 840, 965, 1053, 1122, 1199, 1296, 1395, 1476, 1520, 1645, 1791, 1863, 1911, 1960, 2165, 2344, 4103], 'first': [512, 3134], '(Prx)1': [514], 'discovered': [518], 'were': [519, 2057, 2175, 2185, 2219, 2235, 2307, 2325, 2421, 2444, 2468, 2518, 2577, 2604, 2621, 2641, 2659, 2671, 2694, 2738, 2776, 2786, 2822, 2848, 2930, 2963, 2979, 2988, 2999, 3182, 3194, 3345, 3363, 3387, 3454, 3462, 3481, 3501, 3567, 3662, 3681, 3718, 4025, 4108, 4128, 4209], '25-kDa': [521], 'yeast': [522, 1888, 4244], 'protein': [523, 2602, 2690, 4357], 'initially': [524], 'called': [525, 976], 'thiol-specific': [526, 694, 702], 'antioxidant': [527, 703], 'enzyme': [528, 2080, 3154, 3398, 4158, 4230, 4424], '(4Kim': [529], 'I.H.': [532, 552, 575], 'Lee': [533, 946, 1850], 'K.Y.': [534], 'Stadtman': [537], 'E.R.': [538], '1988;': [542], '263:': [543], '4704-4711Abstract': [544], '5Kim': [551], 'Proc.': [557, 674, 756, 816, 1039, 1108, 1262, 1353, 1712], 'Natl.': [558, 675, 757, 817, 1040, 1109, 1263, 1354, 1713], 'Acad.': [559, 676, 758, 818, 1041, 1110, 1264, 1355, 1714], 'Sci.': [560, 677, 759, 819, 1042, 1111, 1265, 1356, 1715], 'U.': [561, 678, 760, 820, 1043, 1112, 1266, 1357, 1716], 'S.': [562, 679, 761, 821, 1044, 1113, 1267, 1358, 1699, 1717], 'A.': [563, 647, 680, 762, 822, 915, 917, 1045, 1114, 1268, 1359, 1718, 1980, 1986, 4091], '1989;': [564, 610, 632, 1288, 4095], '86:': [565], '6018-6022Crossref': [566], '(131)': [569], '6Chae': [572], '1993;': [583], '268:': [584, 1516, 1567], '16815-16821Abstract': [585], 'Scholar),': [591, 4274], '21-kDa': [594], 'Salmonella': [595], 'typhimurium': [596], 'alkyl-hydroperoxide': [597], 'termed': [599, 988], 'AhpC': [600, 1238], '(7Tartaglia': [601], 'L.A.': [602, 623, 627, 641], 'Storz': [603, 642, 670, 752, 812, 1035, 1258], 'G.': [604, 619, 643, 669, 671, 751, 753, 811, 813, 1034, 1036, 1257, 1259], 'Ames': [605, 628, 648, 1283], 'B.N.': [606, 629, 649, 1284], 'Mol.': [608, 1765], '210:': [611], '709-719Crossref': [612], '(145)': [615], '8Storz': [618], 'Jacobson': [620], 'F.S.': [621, 1278], 'Tartaglia': [622], 'Morgan': [624, 1279], 'R.W.': [625, 1280], 'Silveira': [626], 'Bacteriol.': [631], '171:': [633], '2049-2055Crossref': [634], '(205)': [637], '9Tartaglia': [640], 'Brodsky': [644], 'M.H.': [645], 'Lai': [646], '1990;': [653], '265:': [654], '10535-10540Abstract': [655], '10Chae': [662, 744, 1027], 'Robison': [664, 746, 806, 1029, 1252], 'Poole': [666, 748, 808, 1031, 1254, 1777], 'L.B.': [667, 749, 809, 1032, 1255, 1778, 4089], 'Church': [668, 750, 810, 1033, 1256], '91:': [682, 764, 824, 1047, 1116, 1270, 1361], '7017-7021Crossref': [683, 765, 825, 1048, 1271], '(697)': [686, 768, 828, 1051, 1274], 'Subsequently,': [689], 'mammalian': [691, 715, 794, 852, 869, 1401], 'homolog': [692], 'antioxidant/AhpC': [695], 'purified;': [697], 'it,': [699], 'together': [700], 'AhpC,': [705], 'defined': [706, 3515], 'now': [712, 2064], 'includes': [713], 'six': [714, 851], 'isoforms': [716], 'I–VI)': [718], 'members': [720], 'identified': [721], 'organisms': [723], 'from': [724, 1214, 1798, 1887, 3347, 3495, 3554, 3707, 3728, 3872, 3877, 3884, 3922, 4490], 'each': [725, 3685, 3719, 4405], 'kingdom': [726], '(3Hofmann': [727], '11Chae': [771, 831], 'Biofactors.': [775, 835], '4:': [777, 837], '177-180PubMed': [778, 838], 'All': [781], 'contain': [784, 854, 992, 1803], 'conserved': [786, 857, 971, 995, 1060, 1228, 1405, 1813, 4251], 'residue,': [788], 'corresponds': [790, 865], 'I,': [796], 'N-terminal': [799, 1000, 1059, 1812], 'portion': [800], 'molecule': [803, 4308], '(10Chae': [804, 1250], 'majority': [842], 'proteins,': [845, 2819], 'including': [846, 1400], 'four': [847, 2498], 'I–IV)': [849], 'peroxiredoxins,': [853], 'additional': [856, 2302, 3429, 3532], 'residue': [859, 997], 'C-terminal': [862, 1671, 4250], 'region': [863], 'Cys172': [867, 1940, 2174], '(2Rhee': [872, 1002], '12Matsumoto': [914], 'Okado': [916], 'Fujii': [918, 920, 1508, 1559], 'T.': [919, 1507, 1558, 1709, 1711], 'Egashira': [922], 'M.': [923], 'Niikawa': [924], 'N.': [925, 927, 1511, 1562, 1705, 1734], 'Taniguchi': [926, 1510, 1561], 'FEBS': [928], 'Lett.': [929], '1999;': [930, 1585, 1719, 2337, 3083], '443:': [931], '246-250Crossref': [932], '(130)': [935], '13Seo': [938], 'M.S.': [939, 1153, 1373, 1755, 2143], 'Baines': [944, 1156, 1376, 1436, 1486, 1537, 2146], 'I.C.': [945, 1157, 1377, 1437, 1487, 1538, 2147], 'T.H.': [947], '2000;': [953, 1742, 1767, 1856], '275:': [954], '20346-20354Abstract': [955], '(378)': [963], 'enzymes': [968, 1225, 1311, 1654, 2056, 3344, 3386, 3423, 3448, 4127], 'containing': [969, 1226, 2200, 2398, 2705, 3035, 3179, 3562, 4143], 'two': [970, 1675, 3428, 3531, 3615], 'residues': [973, 1230, 2180, 3534, 3551, 3576, 3587, 3612, 3624, 3634, 3732, 4113], 'thus': [975, 1796], '2-Cys': [977, 1055, 1309, 1650], 'Prx,': [978, 990], 'comparison': [980], 'small': [983, 1316, 1664, 4305], 'number': [984, 2026], '1-Cys': [989, 1397, 1652], 'one': [994, 2211, 3579, 3627], 'cysteine': [996, 1061, 1406, 1428, 1659, 1794, 1814, 1876, 2101, 3533], 'domain': [1001], 'In': [1054, 1297, 1396, 2022, 3520, 3540, 3605, 3647, 3986, 4204], 'enzymes,': [1057, 1399, 2616, 4121], 'oxidized': [1063, 1835, 1929, 3326, 3343, 3385, 3420, 3434, 3445, 3477, 3499, 3545, 3649, 3709, 4004], 'cysteine-sulfenic': [1067], '(Cys51-SOH),': [1069], 'then': [1071, 2259], 'reacts': [1072], 'Cys172-SH': [1074, 4192, 4313], 'other': [1077], 'subunit': [1078], 'produce': [1080], 'intermolecular': [1082], 'disulfide': [1083, 1126, 1432, 1804, 1937, 4196, 4319, 4323], '14Chae': [1102, 1347], 'Uhm': [1104, 1349], 'T.B.': [1105, 1350], '7022-7026Crossref': [1117, 1362], '(280)': [1120, 1365], 'Reduction': [1123], 'I–IV': [1130, 1210], 'specific': [1132], 'it': [1135, 4060, 4285], 'can': [1136, 1312, 1941, 4311], 'achieved': [1138], '(Trx),': [1141], 'GSH': [1145, 1328, 1521], 'or': [1146, 1969, 2240, 2654, 2969, 3171, 3754, 4048, 4486], 'glutaredoxin': [1147], '(15Kang': [1148, 2138], 'Chae': [1150, 1178, 1370, 2140], 'Seo': [1152, 1372, 2142], '1998;': [1163, 1383, 1443, 1469, 1493, 1544, 1605, 1638, 1690, 2153], '273:': [1164, 1384, 1444, 1494, 1545, 1606, 2154], '6297-6302Abstract': [1165, 1385, 2155], '(613)': [1173, 1393, 2163], '16Jin': [1176], 'D.Y.': [1177], 'Jeang': [1182], 'K.T.': [1183], '1997;': [1187], '272:': [1188], '30952-30961Abstract': [1189], '(385)': [1197], 'for': [1204, 1869, 2130, 2208, 2212, 2300, 2500, 2573, 2740, 2753, 2788, 2868, 2990, 3004, 3067, 3319, 3327, 3995, 4184, 4195, 4393], 'peroxidase': [1206, 1306, 3011, 4140, 4287, 4394], 'ultimately': [1212], 'derived': [1213, 3706, 3727, 3871], 'via': [1216], '(TrxR)': [1219], 'Trx.': [1221, 2417, 4379, 4450, 4482], 'Not': [1222], 'all': [1223], 'both': [1227, 1245, 3541, 3563, 3571], 'reduced': [1232, 1240, 1965, 3383, 3397, 3418, 3443, 3475, 3497, 3543, 3607, 3729, 4326], 'Trx:': [1234], 'bacterial': [1236, 2127], 'AhpF,': [1242], 'contains': [1244, 3530], 'Trx': [1246, 1477, 1968, 4217, 4294, 4406, 4437, 4443, 4452, 4474], 'TrxR': [1248, 4148, 4485], 'domains': [1249, 1672], '17Jacobson': [1277], 'Christman': [1281], 'M.F.': [1282], '264:': [1289, 4096], '1488-1496Abstract': [1290], 'absence': [1299, 4435], 'physiological': [1302], 'electron': [1303, 1528], 'donor,': [1304, 1529], 'activities': [1307, 4462], 'supported': [1314, 4280], 'molecules': [1318, 1801, 2111], '(DTT)': [1322], '2-mercaptoethanol,': [1324], '15Kang': [1368], 'VI,': [1403], 'oxidation,': [1412, 3441], 'remains': [1414], 'sulfenic': [1417, 1481, 1920], 'state': [1419], 'upon': [1420, 4031, 4166], 'because': [1422, 4191, 4303], 'there': [1423], 'no': [1425, 4179], 'nearby': [1426], 'partner': [1427], 'form': [1430], 'bond': [1433, 3927], '(18Kang': [1434, 1484, 1535], '6303-6311Abstract': [1445, 1495, 1546], '(407)': [1453, 1503, 1554], '19Choi': [1456], 'Yang': [1460, 1681], 'C.H.': [1461, 1682], 'Ryu': [1464, 1685], 'S.E.': [1465, 1686], 'Nat.': [1466, 1687], 'Struct.': [1467, 1688, 1739], '5:': [1470, 1691], '400-406Crossref': [1471, 1692], '(330)': [1474, 1695], 'acid-containing': [1482], '20Fujii': [1506, 1557], 'Eur.': [1512, 1563], 'Biochem.': [1514, 1565, 1855], '218-225Crossref': [1517, 1568], 'has': [1522, 2135, 4085], 'been': [1523, 2136, 4086], 'proposed': [1524], 'these': [1531, 2053, 3654], 'data': [1532], 'remain': [1533], 'controversial': [1534], '21Fisher': [1572], 'A.B.': [1573], 'Dodia': [1574], 'C.': [1575], 'Manevich': [1576], 'Y.': [1577, 1701, 1982, 1988], 'Chen': [1578], 'J.W.': [1579], 'Feinstein': [1580], 'S.I.': [1581], '274:': [1586], '21326-21334Abstract': [1587], '(243)': [1595], '22Singh': [1598], 'A.K.': [1599], 'Shichi': [1600], 'H.': [1601, 1707], '26171-26178Abstract': [1607], '(67)': [1615], '23Peshenko': [1618], 'I.V.': [1619], 'Novoselov': [1620], 'V.I.': [1621], 'Evdokimov': [1622], 'V.A.': [1623], 'Nikolaev': [1624], 'Y.V.': [1625], 'Kamzalov': [1626], 'S.S.': [1627], 'Shuvaeva': [1628], 'T.M.': [1629], 'Lipkin': [1630], 'V.M.': [1631], 'Fesenko': [1632], 'E.E.': [1633], 'Free': [1634, 1989], 'Radic.': [1635, 1990], 'Med.': [1637, 1992], '25:': [1639], '654-659Crossref': [1640], '(48)': [1643], 'crystal': [1647], 'structures': [1648, 1807], 'reveal': [1655], 'located': [1661], 'pocket': [1665], 'formed': [1666], 'N-': [1669], 'subunits': [1676], '(19Choi': [1677], '24Hirotsu': [1698], 'Abe': [1700], 'Okada': [1702], 'Nagahara': [1704], 'Hori': [1706], 'Nishino': [1708], 'Hakoshima': [1710], '96:': [1720], '12333-12338Crossref': [1721], '(234)': [1724], '25Schröder': [1727], 'E.': [1728, 1759], 'Littlechild': [1729], 'J.A.': [1730], 'Lebedev': [1731], 'A.A.': [1732, 1736], 'Errington': [1733], 'Vagin': [1735], 'Isupov': [1737], 'M.N.': [1738], 'Fold.': [1740], 'Des.': [1741], '8:': [1743], '605-615Abstract': [1744], '(275)': [1751], '26Alphey': [1754], 'Bond': [1756], 'C.S.': [1757], 'Tetaud': [1758], 'Fairlamb': [1760], 'A.H.': [1761], 'Hunter': [1762], 'W.N.': [1763], '300:': [1768, 2338], '903-916Crossref': [1769], '(141)': [1772], '27Wood': [1775], 'Z.A.': [1776], 'Hantgan': [1779], 'R.R.': [1780], 'Karplus': [1781], 'P.A.': [1782], 'Biochemistry.': [1783], '41:': [1785], '5493-5504Crossref': [1786], '(293)': [1789], 'reactive': [1793], 'protected': [1797], 'larger': [1799, 3720], 'oxidant': [1800], 'linkages.': [1805], 'show': [1809], 'surrounded': [1816], 'positively': [1818], 'charged': [1819, 3379, 3775, 3817], 'amino': [1820, 3860], 'residues,': [1822], 'stabilize': [1824], 'thiolate': [1826, 1830], '(Cys-S−)': [1827], 'anion.': [1828], 'anion': [1831], 'readily': [1834, 1890], 'peroxides': [1837], 'than': [1838, 3725, 4214], 'its': [1839], 'protonated': [1840], 'counterpart': [1842], '(Cys-SH)': [1843], '(28Kim': [1844], 'J.R.': [1845], 'Yoon': [1846], 'H.W.': [1847], 'Kwon': [1848], 'K.S.': [1849], 'S.R.': [1851], 'Anal.': [1854], '283:': [1857], '214-221Crossref': [1858], '(242)': [1861], 'This': [1864], 'provides': [1865], 'mechanistic': [1867], 'basis': [1868], 'sensitivity': [1872, 4080], 'active-site': [1875, 2100], 'peroxides.': [1880], 'Previously,': [1881], 'reported': [1883, 4087], 'purified': [1886, 2326, 4022], 'inactivated': [1891, 4368], 'We': [1912, 2062], 'speculated': [1913], 'if': [1918], 'moiety': [1922], 'reaction': [1925, 2381, 2396, 3033, 3349, 4141, 4384, 4471], 'cysteinesulfinic': [1933], '(Cys-SO2H)': [1935], 'before': [1936, 2013, 3999, 4134], 'formation': [1938, 3856, 4064, 4197, 4316], 'occur': [1942, 2049], 'Sulfinic': [1961], 'DTT': [1970, 4212, 4282, 4310], 'included': [1971], 'assay': [1974], 'mixture.': [1975], 'Recently,': [1976], 'Mitsumotoet': [1977], 'al.': [1978], '(29Mitsumoto': [1979], 'Takanezawa': [1981], 'Okawa': [1983], 'Iwamatsu': [1985], 'Nakagawa': [1987], '30:': [1994], '625-635Crossref': [1995], '(104)': [1998], 'Scholar)': [2000], 'used': [2001, 2739, 2752, 2825, 2900, 2989, 3000], 'PAGE': [2003, 3198, 4132], 'compare': [2005], 'human': [2008, 2069, 2131, 3014], 'umbilical': [2009], 'vein': [2010], 'endothelial': [2011], 'after': [2015, 4136, 4464], 'exposure': [2016, 4032, 4040], 'H2O2-treated': [2023], 'cells,': [2024], '(including': [2029], 'II)': [2034], 'demonstrated': [2035], 'altered': [2036, 3602], 'migration': [2037], 'consistent': [2038, 3282], 'pI,': [2041], 'suggesting': [2042, 4170], 'oxidative': [2045, 2121], 'might': [2047], 'cells.': [2051], 'However,': [2052, 3098, 3596, 4002, 4038], 'characterized': [2059], 'detail.': [2061], 'have': [2063], 'investigated': [2065], 'mechanism': [2067], 'Here,': [2075], 'demonstrate': [2077, 3853], 'concomitant': [2083], 'on': [2088, 2555, 2591, 2618, 2915, 2957], 'gels': [2090, 2593, 2620, 2658], 'fact': [2094], 'Cys-SO2H.': [2103, 4176], 'Furthermore,': [2104, 3702, 4021], 'those': [2109, 3726], 'actively': [2112], 'cycle': [2117], 'vulnerable': [2119], 'inactivation.': [2122], 'construction': [2124], 'expression': [2128, 2286], 'vector': [2129, 2224], '(pETprxI-WT)': [2134], 'described': [2137, 2328], 'Two': [2166], 'individually': [2176, 4109], 'replaced': [2177, 4110], 'serine': [2179, 4112], '(C51S': [2181], 'C172S,': [2183, 4186], 'respectively)': [2184], 'standard': [2188, 2976], 'PCR-mediated': [2189], 'site-directed': [2190], 'mutagenesis': [2191], 'pETprxI-WT': [2193], 'template': [2196], 'complementary': [2198], 'primers': [2199], 'single-base': [2202], 'mismatch': [2203], 'converts': [2205], 'codon': [2207], 'Ser.': [2213], 'final': [2215, 2293], 'mutated': [2216], 'PCR': [2217], 'products': [2218, 4017], 'ligated': [2220], 'into': [2221], 'pET': [2223], 'generate': [2226, 4115], 'pETprxI-C51S': [2227], 'pETprxI-C172S.Escherichia': [2229], 'coli': [2230], 'BL21(DE3)': [2231], 'competent': [2232], '(Novagen)': [2234], 'transformed': [2236], 'pETprxI-WT,': [2238], 'pETprxI-C51S,': [2239], 'pETprxI-C172S;': [2241], 'cultured': [2242], '37': [2244], '°C': [2245, 2319, 2357], 'overnight': [2246, 4009], '100': [2248, 2806, 2883], 'ml': [2249], 'LB': [2251, 2266], 'medium': [2252, 2267, 2430, 2461], 'supplemented': [2253, 2434], 'ampicillin': [2255], '(100': [2256], 'μg/ml);': [2257], 'transferred': [2260, 2622], '10': [2262, 2521, 2727, 2941, 3338], 'liters': [2263], 'fresh': [2265, 2459], 'Microferm': [2270], 'fermentor': [2271], '(New': [2272], 'Brunswick': [2273], 'Scientific).': [2274], 'When': [2275, 3672, 4483], 'absorbance': [2277], 'culture': [2280], '600': [2282], 'nm': [2283], 'reached': [2284], '0.6–0.8,': [2285], 'induced': [2288], 'isopropyl-β-d-thiogalactopyranoside': [2290], 'concentration': [2294, 2389, 3117], '0.4': [2296], 'mm.': [2297], 'After': [2298, 2503], 'incubation': [2299, 4137, 4167, 4370, 4467], '3': [2303, 3997], 'h,': [2304], 'collected': [2308, 2787, 3502], 'centrifugation,': [2310], 'frozen': [2311], 'nitrogen,': [2314], 'stored': [2316], '−70': [2318], 'until': [2320], 'used.': [2321], 'recombinant': [2323], '(30Chae': [2329], 'Methods': [2335], 'Enzymol.': [2336], '219-226Crossref': [2339], '(201)': [2342], 'coupled': [2347, 4400], 'reduction': [2350], 'monitored': [2354, 3018], 'decrease': [2360, 3022, 3121], 'inA': [2361, 3023], '340': [2362, 3024], 'using': [2363, 2594, 2673, 2781, 2794, 2834, 2981, 3781, 3823], 'Hewlett-Packard': [2365], 'Model': [2366], '8453': [2367], 'UV-visible': [2368], 'spectrophotometer': [2369], 'equipped': [2370, 2924], 'thermostable': [2373], 'cell': [2374, 2516], 'holder': [2375], 'multicell': [2378], 'transport.': [2379], 'initiated': [2383], 'addition': [2385, 3521], '200-μl': [2395], 'mixture': [2397, 3034, 3350, 4142, 4385, 4472], '50': [2399, 3288], 'mm': [2400, 2487, 2537, 2685, 3335, 3339], 'Hepes-NaOH': [2401], '(pH': [2402, 2550], '7.0),': [2403], '1': [2404, 2450, 2697, 2779, 3143, 3334, 4154], 'mmEDTA,': [2405], '0.8': [2406], 'μm': [2407, 3070, 4449, 4481], 'TrxR,': [2408, 3038, 4220, 4374], 'concentrations': [2412, 3041, 3062, 4377], 'NADPH,': [2415, 3036, 4145, 4373], 'S3': [2419, 2466], 'adapted': [2422], 'suspension': [2424], 'growth': [2425], 'Spinner': [2427], 'minimum': [2428], 'essential': [2429], '(Quality': [2431], 'Biological,': [2432], 'Inc.)': [2433], '10%': [2436], '(v/v)': [2437, 2702, 2707], 'fetal': [2438], 'bovine': [2439], 'serum': [2440], '(Invitrogen).': [2441], 'grown': [2445], 'density': [2448], '×': [2451, 2512, 2686, 2812, 2889], '106': [2452], 'cells/ml': [2453], 'maintained': [2455], 'dilution': [2457], 'every': [2462], '4': [2463, 4448], 'days.': [2464], 'rinsed': [2469], 'three': [2470, 2496, 2815, 2891, 3659, 3791, 3834], 'times': [2471, 2499, 4390], 'ice-cold': [2473], 'phosphate-buffered': [2474], 'saline': [2475], 'lysed': [2477], 'lysis': [2479], 'buffer': [2480, 2525], '(8': [2481, 2526], 'murea,': [2482], '4%': [2483], 'CHAPS,': [2484, 2530], '40': [2486], 'Tris': [2488], 'base)': [2489], 'sonication': [2491], 'sonic': [2494], 'bath': [2495], 's.': [2502, 3225], 'removal': [2504], 'insoluble': [2506], 'materials': [2507], 'centrifugation': [2509], '14,000': [2511], 'gfor': [2513], 'min,': [2515, 2728, 2732, 3594, 3642], 'lysates': [2517], 'mixed': [2519, 2939], 'volumes': [2522], 'rehydration': [2524], 'm': [2527, 3066], 'urea,': [2528], '2%': [2529], '0.5%': [2531], 'immobilized': [2532, 2546, 2569], 'pH': [2533, 2547, 2570], 'gradient': [2534, 2548, 2571, 2704, 2717], 'buffer,': [2535], '20': [2536, 3069], 'DTT,': [2538], '0.005%': [2540], 'bromphenol': [2541], 'blue)': [2542], 'loaded': [2544], 'onto': [2545], 'strips': [2549, 2572], '3–10,': [2551], 'nonlinear).': [2552], 'Isoelectric': [2553], 'focusing': [2554], 'IPGPhor': [2557], 'isoelectrofocusing': [2558], 'unit': [2559], '(Amersham': [2560, 2652], 'Biosciences)': [2561], 'preparation': [2563], '(reduction': [2564], 'alkylation)': [2566], 'second-dimension': [2575], 'SDS-PAGE': [2576, 2588], 'carried': [2578], 'out': [2579], 'according': [2580], 'procedures': [2583], 'recommended': [2584], 'manufacturer.': [2587], 'conducted': [2590], '12%': [2592], 'AmershamBiosciences': [2596], 'SE600': [2597], 'vertical': [2598], 'unit,': [2599], 'spots': [2603], 'visualized': [2605], 'staining': [2607], 'silver': [2609], 'nitrate.': [2610], 'For': [2611, 2689, 2818, 2839, 4404], 'immunoblot': [2612], 'analyses': [2613, 2670], 'electrophoretically': [2623], 'nitrocellulose': [2626], 'membrane,': [2627], 'membrane': [2630], 'incubated': [2632], 'rabbit': [2634], 'antibodies': [2635, 2647], 'I.': [2638, 3519], 'Immune': [2639], 'complexes': [2640], 'horseradish': [2644], 'peroxidase-conjugated': [2645], 'secondary': [2646], 'enhanced': [2649, 3261], 'chemiluminescence': [2650], 'reagents': [2651], 'Biosciences': [2653], 'Pierce).': [2655], 'Silver-stained': [2656], 'scanned': [2660], 'Dynamics': [2664], 'SI': [2665], 'personal': [2666], 'densitometer.': [2667], 'Reverse-phase': [2668], 'HPLC': [2669, 2677, 2766, 3353, 3466, 3470, 3556, 4000], 'performed': [2672, 2914], 'Agilent': [2675], '1100': [2676], 'system': [2678, 4218, 4295], 'Vydac': [2681], '218TP54': [2682], 'column': [2683, 3557], '(0.47': [2684], '25': [2687], 'cm).': [2688], 'analysis,': [2691], 'injected': [2692], 'samples': [2693, 3193], 'eluted': [2695, 3553, 3589, 3636, 3667], 'ml/min': [2698], '5–35%': [2701], 'acetonitrile/water': [2703], '0.04%': [2706], 'trifluoroacetic': [2708, 2950], 'over': [2710, 2718, 2726, 2730, 2735], '15': [2711, 2721], 'min': [2712, 2737, 3329, 3489, 3680, 3717], '35–60%': [2716], 'next': [2720], 'min.': [2722, 3560], 'Gradients': [2723], '5–10%': [2725], '10–40%': [2729], '40–60%': [2734], 'peptide': [2741, 3493, 3549, 3873, 3926], 'analysis.': [2742, 3199, 4001], 'A': [2743, 3200, 3453], 'Finnigan': [2744, 2835], 'MAT': [2745, 2836], 'LCQ': [2746], 'ion-trap': [2748], 'spectrometer': [2750, 2852], 'sequence': [2760, 2840, 3862], 'Cys51-containing': [2763, 3599, 3660, 3768], 'peptides.': [2764, 4078], 'Dried': [2765], 'fractions': [2767], 'dissolved': [2768, 2931], '75%': [2770], 'acetonitrile': [2771, 2934], '0.1%': [2773, 2949], 'acetic': [2774], 'introduced': [2777], 'μl/min': [2780], 'syringe': [2783], 'pump.': [2784], 'Data': [2785], 'positive': [2789], 'ions': [2790, 2847, 3380, 3705, 3776, 3818, 3911], '300–2000': [2792], 'm/z': [2793], 'settings:': [2797], 'capillary': [2798, 2875], 'temperature,': [2799, 2876], '215': [2800, 2877], '°C;': [2801, 2878], 'maximum': [2802, 2879], 'ion': [2803, 2880, 3694, 3866, 3897], 'inject': [2804, 2881], 'time,': [2805, 2882, 3103], 'ms;': [2807, 2884], 'full': [2808, 2885], 'scan': [2809, 2886], 'target,': [2810, 2887], '9': [2811], '107;': [2813, 2890], 'microscans/full': [2816, 2892], 'scan.': [2817], 'ESI-MS': [2820, 3366], 'spectra': [2821, 2861, 2870, 2962], 'obtained': [2823, 2964], 'calculate': [2827], 'masses': [2829, 3358, 3371, 3879], 'deconvolution': [2833], 'BioWorks': [2837], 'software.': [2838], 'peptides,': [2843, 2993], 'once': [2844], 'parent': [2846, 2864], 'identified,': [2849], 'set': [2854], 'up': [2855], 'obtain': [2857], 'collision-induced': [2858, 3885, 3891], 'dissociation': [2859, 3886, 3892], 'MS/MS': [2860, 2869, 3893], 'ions.': [2865], 'instrument': [2867, 2919], 'configured': [2872], 'follows:': [2874], '2': [2888, 3368, 3452, 3645, 3739, 3902], 'scan;': [2893], 'window,': [2895], '2.5;': [2896], 'collision': [2898], 'energy,': [2899], 'within': [2901], 'range': [2903], '0–50%.': [2905], 'tryptic': [2911, 3966], 'peptides': [2912, 2987, 3461, 3480, 3574, 3600, 3610, 3661, 3710, 3730, 3967, 4013, 4024, 4030], 'Voyager-STR': [2917], 'MALDI-TOF': [2918], '(PerSeptive': [2920, 2984], 'Biosystems,': [2921], 'Framingham,': [2922], 'MA)': [2923], 'nitrogen': [2927], 'laser.': [2928], 'Samples': [2929], '50%': [2933], '5%': [2936], 'formic': [2937], 'acid,': [2938], 'mg/ml': [2942], '3,5-dimethoxy-4-hydroxycinnamic': [2943], '(sinapinic': [2945], 'acid;': [2946], 'Aldrich)': [2947], '70%': [2953], 'acetonitrile,': [2954], 'spotted': [2956], 'sample': [2959], 'plate.': [2960], 'positive-ion': [2967], 'reflector': [2968], 'linear': [2970], 'mode': [2971], 'delayed': [2973], 'extraction': [2974], 'under': [2975], 'conditions.': [2977], 'Spectra': [2978], 'analyzed': [2980, 3504, 3682], 'DataExplorer': [2982], 'software': [2983, 3783, 3825], 'Biosystems).': [2985], 'Standard': [2986], 'calibration': [2991, 3007], 'whereas': [2994, 4232], 'apomyoglobin': [2995], 'carbonic': [2997], 'anhydrase': [2998], 'internal': [3002], 'standards': [3003], 'scale': [3006], 'proteins.': [3009], 'attributable': [3025, 3166], 'Trx,': [3037, 4146], 'varying': [3040, 4376], 'initial': [3045, 4409], '(the': [3050, 3133, 3213], 'slope': [3051], 't': [3053], '=': [3054], '0)': [3055], 'independent': [3057], 'saturating': [3061], '(0.1–1': [3063], 'mm)': [3064], '(K': [3065], 'H2O2<': [3068], '(31Chae': [3071], 'Diabetes': [3079], 'Res.': [3080], 'Clin.': [3081], 'Pract.': [3082], '45:': [3084], '101-112Abstract': [3085], '(317)': [3093], 'Scholar))': [3095], '(Fig.1': [3096], 'A).': [3097, 3355, 4427], 'higher': [3106], 'H2O2concentration,': [3108], 'faster': [3110], 'decrease.': [3114], 'dependence': [3118, 4453], 'shown': [3123, 3150, 3899, 4241], 'quantitatively': [3125], 'plotting': [3127, 4459], 'derivative': [3135], 'curve)': [3140], 'versustime': [3141], '(Fig.': [3142, 3367, 3644, 3738], 'B).': [3144, 3369], 'Replenishment': [3145], 'restore': [3152], 'rate,': [3155], 'markedly': [3159], 'exhaustion': [3168], 'substrate': [3170], 'product': [3173], 'inhibition': [3174], '(data': [3175, 4018, 4035, 4056, 4296], 'shown).': [3177, 4020, 4037, 4058, 4298], 'Reactions': [3178], '200': [3180], 'μmH2O2': [3181], 'stopped': [3183], '0,': [3185], '60,': [3186], '150': [3188, 3252, 3298], 's,': [3189, 3228, 3253, 3299], 'resulting': [3192], 'subjected': [3195, 4129], 'single': [3201], 'spot': [3202, 3232, 3242, 3259, 3280], 'position': [3205, 3248, 4165], 'corresponding': [3206, 3656], 'value': [3210], '8.1': [3212], 'theoretical': [3214, 3405], '8.2)': [3220], '0': [3224], 'At': [3226, 3251], '60': [3227, 3296], 'however,': [3229, 3651], 'new': [3231, 3850], 'whose': [3233], 'intensity': [3234, 3255], 'similar': [3236], 'original': [3241, 3267, 3279], '(pI': [3249], '7.6).': [3250], 'expense': [3264], 'spot.': [3268], 'increasing': [3270, 4442], 'proportion': [3271], 'compared': [3276], 'notion': [3285], '80%': [3290], 'decreases': [3291], 'related': [3302], 'derivative.': [3313], 'To': [3314, 3436, 3852, 4348], 'identify': [3315], 'modification': [3317], 'responsible': [3318], 'shift,': [3322], '5': [3328], 'DTT.': [3340, 4328], 'Reduced': [3341], 'separated': [3346, 3361, 3449, 3695], 'reverse-phase': [3352, 3465], '(Fig.2': [3354, 3467, 3490, 3700], 'molecular': [3357], 'measured': [3364, 4463], 'calculated': [3372, 3780, 3822], 'fromm/z': [3373], 'total': [3375], 'charge': [3376], 'multiply': [3378], '21,979': [3388], '22,011': [3390], 'Da,': [3391], 'respectively.': [3392, 3595, 4122], 'good': [3401], 'agreement': [3402], '21,979.2': [3408], 'Da.': [3409], 'difference': [3411], '32': [3413, 3722], 'units': [3415, 3699, 3724], 'between': [3416, 3485, 3928, 3935, 3941, 3947], 'suggests': [3424], 'oxygen': [3430], 'atoms': [3431], 'species.': [3435], 'determine': [3437], 'Fig.': [3451, 3901, 3987, 4153], 'digested': [3455, 3992, 4008], 'trypsin,': [3457, 4011], 'resultant': [3460], 'fractionated': [3463], 'C).': [3468, 3491], 'elution': [3471], 'profiles': [3472], 'nearly': [3482], 'identical': [3483], 'except': [3484], '48': [3486], '56': [3488], 'Major': [3492], 'peaks': [3494, 3513, 3655, 3666, 3674], 'MALDI-TOF-MS,': [3506, 3684], 'enabling': [3507], 'assignment': [3509], '12': [3511], 'fragments': [3516, 3882], 'disulfide-forming': [3524], 'Cys172residues,': [3527], 'positions': [3536], '70': [3537], '82.': [3539], 'states,': [3546, 3572], 'Cys172-containing': [3548], 'encompassing': [3550, 3575, 3611, 3731], '168–189': [3552], '26.1': [3559], 'Peptides': [3561], 'Cys70': [3564], 'Cys82': [3566], 'unchanged:': [3569], '67–91': [3577], '(representing': [3578, 3614, 3626], 'missed': [3580, 3616, 3628], 'trypsin': [3581, 3617, 3994], 'cleavage': [3582, 3618, 3629, 3923], 'Lys67)': [3585], '68–91': [3588], '35.5': [3591], '36.8': [3593], 'retention': [3597], 'oxidation.': [3604], 'state,': [3608], '27–61': [3613], 'sites': [3619], 'Lys34': [3621], 'Lys36),': [3623, 3632], '35–61': [3625], '37–61': [3635, 3874], '50.8,': [3638], '51.7,': [3639], '55.1': [3641], 'respectively': [3643, 3737], 'D).': [3646, 3701], 'protein,': [3650], 'none': [3652], 'observed.': [3663], 'Instead,': [3664], 'several': [3665], 'near': [3668], 'expected': [3670], 'positions.': [3671], '49.7,': [3676, 3713], '50.4,': [3677, 3714], '53.0': [3679, 3716], 'them': [3687], 'displayed': [3688, 4457], 'dominant': [3690, 3704, 3865], 'minor': [3693], '16': [3697], 'eluting': [3711], '27–61,': [3733], '35–61,': [3734], '37–61,': [3736], 'Dand': [3740], 'Table': [3741], 'I).': [3742], 'These': [3743, 4329], 'results': [3744, 4330], 'support': [3745], 'model': [3747], 'wherein': [3748], 'Cys51-SH,': [3749], 'Cys70-SH,': [3752], 'Cys82-SH,': [3753], 'Cys172-SH,': [3755], 'Cys-SO2H': [3761, 3958, 4082], 'cysteic': [3763, 4053, 4066], '(Cys-SO3H).Table': [3765], 'ICharacterization': [3766], 'peptidesResiduesRetention': [3769], 'timeMassSequenceTheoretical1-aTheoretical': [3770], 'averagem/z': [3771, 3813], 'values': [3772, 3814], 'singly': [3774, 3816], '([M': [3777, 3819, 3867], '+': [3778, 3820, 3868], 'H]+)': [3779, 3821], 'GPMAW': [3782, 3824], '(Lighthouse': [3784, 3826], 'Data,': [3785, 3827], 'Odense,': [3786, 3828], 'Denmark).m/zObserved1-bAverage': [3787], 'least': [3790, 3833], 'separate': [3792, 3835], 'experiments': [3793, 3836], 'S.D.': [3795, 3838], '<0.02%.m/zmin27–611-cCys51-SH-containing': [3796], 'peptide.50.84145.84145.4DISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDR27–61-O2': [3797], '1-dCys51-SO2H-containing': [3798, 3803, 3808], 'peptide.49.74177.84177.527–61-O3': [3799], '1-eCys51-SO3H-containing': [3800, 3805, 3810], 'peptide.4193.84193.135–611-cCys51-SH-containing': [3801], 'peptide.51.73223.83222.9GKYVVFFFYPLDFTFVCPTEIIAFSDR35–61-O2': [3802], 'peptide.50.43255.83254.935–61-O3': [3804], 'peptide.3271.83270.837–611-cCys51-SH-containing': [3806], 'peptide.55.13038.53038.3YVVFFFYPLDFTFVCPTEIIAFSDR37–61-O2': [3807], 'peptide.53.03070.53070.337–61-O3': [3809], 'peptide.3086.53086.11-a': [3811], 'Theoretical': [3812], 'Denmark).1-b': [3829], 'Average': [3830], '<0.02%.1-c': [3839], 'Cys51-SH-containing': [3840], 'peptide.1-d': [3841], 'Cys51-SO2H-containing': [3842, 4023], 'peptide.1-e': [3843], 'Cys51-SO3H-containing': [3844, 4012, 4029], 'peptide.': [3845, 3889], 'Open': [3846], 'table': [3847], 'tab': [3851], 'directly': [3854], '2H]2+,': [3869], 'm/z1535.90)': [3870], 'arising': [3883], 'spectrum': [3894], 'E,': [3903], 'along': [3904], 'interpretation.': [3907], 'major': [3909, 4016], 'daughter': [3910], 'y10': [3913], '(m/z1148.5)': [3914], 'b15': [3916, 3938], '(m/z': [3917], '1922.5)': [3918], 'ions,': [3919], 'derive': [3921], 'Pro52.': [3931], 'differences': [3934], 'b14': [3936], '(135.2': [3939], 'Da),': [3940, 3945], 'y10and': [3942], 'y11': [3943], '(135.0': [3944, 3951], 'z10': [3948], 'z11': [3950], 'Da)': [3952], 'clearly': [3953], 'indicate': [3954, 4331], 'Cys51.': [3960], 'suggested': [3968], 'yielded': [3976], 'mainly': [3977], 'Cys51-SO3H': [3981], 'lesser': [3984], 'extent.': [3985], '2,': [3988], 'h': [3998], 'became': [4014, 4224], 'slowly': [4026, 4432], 'autoxidized': [4027], 'air': [4034, 4049, 4074, 4084], 'longer': [4039], 'intact': [4042], 'either': [4046, 4484], 'did': [4050, 4200], 'increase': [4052], 'content': [4055], 'Therefore,': [4059], 'appears': [4061], 'derivatives': [4068], 'result': [4071], 'Cys-SO2H-containing': [4077], '(32Poole': [4088], 'Claiborne': [4090], '12330-12338Abstract': [4097], 'Cysteines': [4104], '51': [4105], '172': [4107], 'C51S': [4117, 4233], 'C172S': [4119, 4223, 4275], 'wild-type': [4124, 4157, 4229], '(Fig.3).': [4149], 'As': [4150, 4177, 4239], 'C,': [4155], 'migrated': [4159], 'predominantly': [4160], 'expected,': [4178], 'C51S.': [4185], 'catalytically': [4189], 'inactive': [4190], 'Cys51-SOH,': [4199], 'hyperoxidation.': [4203, 4238], 'contrast,': [4205], 'rather': [4213], '(Trx,': [4219], 'NADPH),': [4222], 'just': [4226], 'did,': [4231], 'still': [4235], 'resistant': [4236], 'previously': [4240], 'changed': [4254], 'Ser': [4256], 'fully': [4277], 'active': [4278], 'even': [4283], 'though': [4284], 'lacks': [4286], 'Such': [4299], 'possible': [4302], 'diffusible': [4306], 'like': [4309], 'replace': [4312], 'Cys51-SOH.': [4321], 'subsequently': [4325], 'Cys51-SO2H': [4337], 'examine': [4350], 'whether': [4351], 'accumulation': [4353], 'requires': [4358], 'continuous': [4359], 'passage': [4360], 'through': [4361], 'cycle,': [4364], 'An': [4380], 'aliquot': [4381], 'removed': [4387], 'various': [4389], 'assayed': [4392], 'measuring': [4397], 'reduction.': [4403], 'concentration,': [4407], 'plotted': [4415], 'against': [4416, 4473], 'duration': [4417], 'yield': [4421], 'rates': [4422], '(Fig.4': [4426], 'proceeded': [4431], 'increased': [4439], 'concentrations,': [4444], 'reaching': [4445], 'saturation': [4446], 'residual': [4461], '3-min': [4466], 'concentration.': [4475], 'Half-maximal': [4476], 'occurred': [4478], '<0.5': [4480], 'omitted': [4489], 'i': [4492]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2098048169', 'counts_by_year': [{'year': 2024, 'cited_by_count': 14}, {'year': 2023, 'cited_by_count': 16}, {'year': 2022, 'cited_by_count': 7}, {'year': 2021, 'cited_by_count': 11}, {'year': 2020, 'cited_by_count': 11}, {'year': 2019, 'cited_by_count': 15}, {'year': 2018, 'cited_by_count': 21}, {'year': 2017, 'cited_by_count': 19}, {'year': 2016, 'cited_by_count': 19}, {'year': 2015, 'cited_by_count': 24}, {'year': 2014, 'cited_by_count': 22}, {'year': 2013, 'cited_by_count': 27}, {'year': 2012, 'cited_by_count': 26}], 'updated_date': '2024-12-12T10:08:52.856983', 'created_date': '2016-06-24'}