Publication Information

{'id': 'https://openalex.org/W2090050973', 'doi': 'https://doi.org/10.1074/jbc.m006252200', 'title': 'The Cytoplasmic C-terminal Fragment of Polycystin-1 Regulates a Ca2+-permeable Cation Channel', 'display_name': 'The Cytoplasmic C-terminal Fragment of Polycystin-1 Regulates a Ca2+-permeable Cation Channel', 'publication_year': 2001, 'publication_date': '2001-02-01', 'ids': {'openalex': 'https://openalex.org/W2090050973', 'doi': 'https://doi.org/10.1074/jbc.m006252200', 'mag': '2090050973', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/11044446'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m006252200', 'pdf_url': 'http://www.jbc.org/article/S0021925818464095/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925818464095/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5112190673', 'display_name': 'David H. Vandorpe', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'David H. Vandorpe', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5091902229', 'display_name': 'Marina N. Chernova', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Marina N. Chernova', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5109075781', 'display_name': 'Lianwei Jiang', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Lianwei Jiang', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5042460929', 'display_name': 'Lorenz Sellin', 'orcid': 'https://orcid.org/0000-0002-3762-1850'}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Lorenz K. Sellin', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5060482398', 'display_name': 'Sabine Wilhelm', 'orcid': 'https://orcid.org/0000-0002-5316-2711'}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Sabine Wilhelm', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5079165664', 'display_name': 'Alan K. Stuart-Tilley', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Alan K. Stuart-Tilley', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5048410197', 'display_name': 'Gerd Walz', 'orcid': 'https://orcid.org/0000-0002-4950-9946'}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Gerd Walz', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5014312110', 'display_name': 'Seth L. Alper', 'orcid': 'https://orcid.org/0000-0002-6228-2512'}, 'institutions': [{'id': 'https://openalex.org/I1316535847', 'display_name': 'Beth Israel Deaconess Medical Center', 'ror': 'https://ror.org/04drvxt59', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1316535847']}, {'id': 'https://openalex.org/I136199984', 'display_name': 'Harvard University', 'ror': 'https://ror.org/03vek6s52', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I136199984']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Seth L. Alper', 'raw_affiliation_strings': ['From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215'], 'affiliations': [{'raw_affiliation_string': 'From the Molecular Medicine and Renal Units, Beth Israel Deaconess Medical Center and the Departments of Medicine and Cell Biology, Harvard Medical School, Boston, Massachusetts 02215', 'institution_ids': ['https://openalex.org/I1316535847', 'https://openalex.org/I136199984']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 4.684, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 72, 'citation_normalized_percentile': {'value': 0.842594, 'is_in_top_1_percent': False, 'is_in_top_10_percent': False}, 'cited_by_percentile_year': {'min': 94, 'max': 95}, 'biblio': {'volume': '276', 'issue': '6', 'first_page': '4093', 'last_page': '4101'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T11412', 'display_name': 'Genetic and Kidney Cyst Diseases', 'score': 0.9995, 'subfield': {'id': 'https://openalex.org/subfields/1311', 'display_name': 'Genetics'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T11412', 'display_name': 'Genetic and Kidney Cyst Diseases', 'score': 0.9995, 'subfield': {'id': 'https://openalex.org/subfields/1311', 'display_name': 'Genetics'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11879', 'display_name': 'Protist diversity and phylogeny', 'score': 0.9934, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T10492', 'display_name': 'Microtubule and mitosis dynamics', 'score': 0.9656, 'subfield': {'id': 'https://openalex.org/subfields/1307', 'display_name': 'Cell Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/fragment', 'display_name': 'Fragment (logic)', 'score': 0.7701285}], 'concepts': [{'id': 'https://openalex.org/C2776235265', 'wikidata': 'https://www.wikidata.org/wiki/Q18392052', 'display_name': 'Fragment (logic)', 'level': 2, 'score': 0.7701285}, {'id': 'https://openalex.org/C2779664074', 'wikidata': 'https://www.wikidata.org/wiki/Q3518405', 'display_name': 'Terminal (telecommunication)', 'level': 2, 'score': 0.70549047}, {'id': 'https://openalex.org/C190062978', 'wikidata': 'https://www.wikidata.org/wiki/Q79899', 'display_name': 'Cytoplasm', 'level': 2, 'score': 0.59780556}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.5658093}, {'id': 'https://openalex.org/C12554922', 'wikidata': 'https://www.wikidata.org/wiki/Q7100', 'display_name': 'Biophysics', 'level': 1, 'score': 0.5239613}, {'id': 'https://openalex.org/C95444343', 'wikidata': 'https://www.wikidata.org/wiki/Q7141', 'display_name': 'Cell biology', 'level': 1, 'score': 0.37257412}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.19116661}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.16350943}, {'id': 'https://openalex.org/C41008148', 'wikidata': 'https://www.wikidata.org/wiki/Q21198', 'display_name': 'Computer science', 'level': 0, 'score': 0.11579135}, {'id': 'https://openalex.org/C31258907', 'wikidata': 'https://www.wikidata.org/wiki/Q1301371', 'display_name': 'Computer network', 'level': 1, 'score': 0.114236474}, {'id': 'https://openalex.org/C11413529', 'wikidata': 'https://www.wikidata.org/wiki/Q8366', 'display_name': 'Algorithm', 'level': 1, 'score': 0.05986178}], 'mesh': [{'descriptor_ui': 'D015220', 'descriptor_name': 'Calcium Channels', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': True}, {'descriptor_ui': 'D011506', 'descriptor_name': 'Proteins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': True}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000818', 'descriptor_name': 'Animals', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D015220', 'descriptor_name': 'Calcium Channels', 'qualifier_ui': 'Q000502', 'qualifier_name': 'physiology', 'is_major_topic': False}, {'descriptor_ui': 'D015220', 'descriptor_name': 'Calcium Channels', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D018408', 'descriptor_name': 'Patch-Clamp Techniques', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D010446', 'descriptor_name': 'Peptide Fragments', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010539', 'descriptor_name': 'Permeability', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011506', 'descriptor_name': 'Proteins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D050396', 'descriptor_name': 'TRPP Cation Channels', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D014981', 'descriptor_name': 'Xenopus', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m006252200', 'pdf_url': 'http://www.jbc.org/article/S0021925818464095/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/11044446', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m006252200', 'pdf_url': 'http://www.jbc.org/article/S0021925818464095/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 45, 'referenced_works': ['https://openalex.org/W1480317735', 'https://openalex.org/W1592452759', 'https://openalex.org/W1966685035', 'https://openalex.org/W1969887954', 'https://openalex.org/W1975792086', 'https://openalex.org/W1977475418', 'https://openalex.org/W1979856671', 'https://openalex.org/W1984615286', 'https://openalex.org/W1992155993', 'https://openalex.org/W2002007337', 'https://openalex.org/W2005026678', 'https://openalex.org/W2007225462', 'https://openalex.org/W2010237592', 'https://openalex.org/W2012635677', 'https://openalex.org/W2014604277', 'https://openalex.org/W2018070639', 'https://openalex.org/W2019562200', 'https://openalex.org/W2022410485', 'https://openalex.org/W2041690080', 'https://openalex.org/W2042582068', 'https://openalex.org/W2046083880', 'https://openalex.org/W2048209974', 'https://openalex.org/W2057244276', 'https://openalex.org/W2062916647', 'https://openalex.org/W2065225319', 'https://openalex.org/W2074061748', 'https://openalex.org/W2077815163', 'https://openalex.org/W2078603061', 'https://openalex.org/W2080853555', 'https://openalex.org/W2080931623', 'https://openalex.org/W2081659168', 'https://openalex.org/W2082013033', 'https://openalex.org/W2085353394', 'https://openalex.org/W2088811685', 'https://openalex.org/W2102060480', 'https://openalex.org/W2113588019', 'https://openalex.org/W2116586217', 'https://openalex.org/W2135512519', 'https://openalex.org/W2135589742', 'https://openalex.org/W2136875701', 'https://openalex.org/W2138263101', 'https://openalex.org/W2146041633', 'https://openalex.org/W2146856227', 'https://openalex.org/W2154435852', 'https://openalex.org/W2260773538'], 'related_works': ['https://openalex.org/W4253208712', 'https://openalex.org/W31439402', 'https://openalex.org/W3132641048', 'https://openalex.org/W2984753899', 'https://openalex.org/W2805502594', 'https://openalex.org/W2783178962', 'https://openalex.org/W2525971763', 'https://openalex.org/W2217679042', 'https://openalex.org/W1973480752', 'https://openalex.org/W1603677234'], 'abstract_inverted_index': {'The': [0, 231, 523, 622, 1533, 1877, 2013, 2191, 2216, 2291, 3406, 3492, 3546, 3589, 3721, 3803, 3853, 4012, 4096, 4403, 4436, 4489, 4505, 4526], 'cytoplasmic': [1, 68, 195, 232, 299, 426, 620, 949, 1063, 1163, 1490, 1506, 1717, 1887, 1915, 1980, 1994, 2020, 2175, 2258, 2280, 2358, 3618], 'C-terminal': [2, 63, 194, 233, 294, 425, 619, 911, 948, 967, 1062, 1158, 1489, 1505, 1540, 1716, 1886, 1916, 1993, 2019, 2132, 2139, 2153, 2171, 2188, 2197, 2231, 2281, 2357, 3619], 'portion': [3, 64, 234, 295], 'of': [4, 56, 65, 136, 141, 151, 180, 197, 213, 235, 287, 296, 367, 372, 382, 411, 428, 444, 482, 625, 634, 678, 686, 694, 704, 756, 909, 944, 956, 965, 1086, 1155, 1160, 1187, 1191, 1441, 1539, 1542, 1548, 1550, 1714, 1719, 1723, 1883, 1913, 1918, 1936, 1950, 1988, 1996, 2022, 2135, 2150, 2166, 2201, 2226, 2229, 2261, 2268, 2285, 2572, 2579, 2678, 2683, 2728, 2743, 2884, 2913, 2955, 2977, 3023, 3033, 3039, 3045, 3054, 3069, 3237, 3473, 3549, 3562, 3615, 3637, 3663, 3683, 3687, 3698, 3746, 3756, 3766, 3813, 3815, 3824, 3856, 3979, 3987, 4008, 4016, 4098, 4120, 4187, 4196, 4387, 4429, 4481, 4492, 4522], 'the': [5, 33, 52, 62, 66, 73, 187, 193, 236, 264, 283, 293, 297, 304, 418, 424, 494, 628, 676, 683, 691, 702, 705, 732, 741, 754, 838, 910, 945, 1060, 1156, 1161, 1188, 1233, 1368, 1434, 1503, 1715, 1834, 1884, 1910, 1914, 1946, 1956, 1989, 1997, 2008, 2017, 2131, 2136, 2146, 2151, 2195, 2208, 2262, 2286, 2363, 2380, 2573, 2882, 2967, 2975, 3121, 3130, 3139, 3192, 3209, 3262, 3346, 3499, 3521, 3555, 3616, 3632, 3699, 3747, 3770, 3774, 3811, 3825, 3847, 3857, 3942, 3977, 3980, 3984, 3992, 4188, 4234, 4349, 4383, 4406, 4422, 4427, 4472, 4514], 'polycystin-1': [6, 237, 495], 'polypeptide': [7, 238, 526, 2260], '(PKD1(1–226))': [8, 239], 'regulates': [9, 240], 'several': [10, 241, 2756, 2790, 2827], 'important': [11, 242], 'cell': [12, 93, 243, 324, 2374, 3557], 'signaling': [13, 244, 940, 1167, 1534, 1879], 'pathways,': [14, 245], 'and': [15, 32, 102, 104, 109, 157, 160, 173, 246, 263, 333, 335, 340, 388, 391, 404, 578, 631, 738, 740, 941, 1067, 1181, 1231, 1364, 1443, 1725, 1752, 1756, 1761, 1833, 1837, 1880, 1930, 2027, 2248, 2315, 2372, 2390, 2578, 2604, 2733, 2835, 2859, 2888, 2910, 2943, 2961, 2985, 3010, 3014, 3038, 3060, 3072, 3137, 3170, 3188, 3191, 3217, 3267, 3350, 3358, 3401, 3490, 3551, 3554, 3565, 3573, 3674, 3725, 3794, 3840, 3884, 3927, 3956, 3997, 4072, 4202, 4217, 4238, 4304, 4379, 4424], 'its': [16, 247, 1488], 'deletion': [17, 248], 'suffices': [18, 249, 914], 'to': [19, 38, 97, 226, 250, 269, 328, 457, 491, 690, 746, 915, 1175, 1185, 1367, 1891, 1955, 1986, 2305, 2362, 2385, 2391, 2689, 2699, 2843, 2863, 2929, 2993, 3066, 3159, 3233, 3242, 3248, 3323, 3330, 3334, 3449, 3630, 3645, 3666, 3822, 3876, 3904, 3919, 4033, 4043, 4058, 4081, 4159, 4169, 4243, 4417, 4443, 4487, 4513, 4518], 'cause': [20, 251, 916], 'autosomal': [21, 219, 252, 450, 462, 483], 'dominant': [22, 220, 253, 451, 463, 484], 'polycystic': [23, 221, 254, 452, 464, 467, 485], 'kidney': [24, 222, 255, 453, 465, 468, 486, 1845], 'disease.': [25, 256], 'However,': [26, 257], 'a': [27, 57, 77, 131, 204, 258, 288, 308, 362, 435, 528, 537, 541, 579, 611, 617, 728, 1069, 1438, 1829, 1923, 1931, 2186, 2224, 2257, 2277, 2300, 2306, 2681, 2741, 2846, 2872, 2885, 2902, 2920, 2930, 2935, 2986, 3067, 3135, 3154, 3160, 3234, 3463, 4009, 4024, 4034, 4127], 'functional': [28, 259], 'link': [29, 260, 730], 'between': [30, 261, 731, 2959], 'PKD1': [31, 67, 198, 262, 298, 429, 525, 737, 762, 839, 947, 1061, 1162, 1504, 1543, 1720, 1824, 1885, 1919, 2000, 2023, 2138, 2152, 2174, 2234, 2240, 2245, 2251, 2356, 2382, 3617], 'ion': [34, 265, 742, 1897, 3854], 'transport': [35, 266, 743, 1898], 'processes': [36, 267, 744, 1899], 'required': [37, 268, 745, 1082, 3634], 'drive': [39, 270], 'renal': [40, 271, 635, 647], 'cyst': [41, 227, 272, 458, 748, 1904], 'enlargement': [42, 273], 'has': [43, 274, 527, 750], 'remained': [44, 275, 751], 'elusive.': [45, 276], 'We': [46, 190, 277, 421, 1906], 'report': [47, 278, 1908], 'here': [48, 279], 'that': [49, 192, 202, 280, 423, 433, 1893, 1900, 1909, 3823, 4104, 4179, 4405], 'expression': [50, 281, 2010, 2376, 3682, 3745, 4480], 'at': [51, 282, 2207, 2740, 2748, 3167, 3172, 3264, 3269, 3348, 3495, 3653, 3714, 3769, 3788, 3810, 3818, 3911, 3963, 4051, 4439], 'Xenopus': [53, 284, 1937, 2600, 3471], 'oocyte': [54, 84, 285, 315, 2009, 2209, 2214, 2601, 3131, 3711, 3743, 3771, 4531], 'surface': [55, 286, 2375, 3744, 3772, 3812], 'transmembrane': [58, 289, 477, 614, 958, 1924, 1959, 2365], 'fusion': [59, 290, 959, 1057, 1552, 1925, 1942, 2003, 2203, 3623, 3749], 'protein': [60, 291, 1058, 1235, 1553, 2369], 'encoding': [61, 292, 2239, 2244, 2250], 'tail,': [69, 300, 1164], 'PKD1(115–226),': [70, 301, 1165], 'but': [71, 118, 302, 349, 727, 907, 2211, 2267, 3732], 'not': [72, 113, 303, 344, 3481, 3676, 3693, 3707, 3733, 3738, 3801, 3838, 4279, 4312, 4368], 'N-terminal': [74, 305, 530, 1077, 1947, 2147], 'portion,': [75, 306], 'induced': [76, 307, 4189], 'large,': [78, 309], 'Ca2+-permeable': [79, 208, 310, 439, 1932], 'cation': [80, 139, 188, 210, 311, 370, 419, 441, 1444, 1934, 3048, 3638, 3982, 4010, 4185, 4240, 4474], 'current,': [81, 312], 'which': [82, 313, 1945, 2169, 3642, 3845], 'shifted': [83, 314, 4348], 'reversal': [85, 316, 3558], 'potential': [86, 317, 939, 2992, 3016, 4507, 4520], '(E': [87, 318, 3560], 'rev)': [88, 319, 3561], 'by': [89, 99, 107, 115, 121, 165, 177, 320, 330, 338, 346, 352, 396, 408, 1168, 1502, 2299, 2558, 2584, 2966, 2974, 3030, 3051, 3128, 3260, 3343, 3538, 3582, 3647, 3730, 3734, 3740, 3781, 3862, 4005, 4023, 4068, 4092, 4123, 4193, 4212, 4299, 4414, 4479], '+33': [90, 321], 'mV.': [91, 322, 3019], 'Whole': [92, 323], 'currents': [94, 154, 325, 385, 3590, 3639, 3651, 4372, 4494], 'were': [95, 112, 119, 175, 326, 343, 350, 406, 2005, 2205, 2556, 2594, 2606, 2697, 2717, 2761, 2784, 2802, 2807, 2854, 2869, 2896, 2917, 2964, 3022, 3029, 3064, 3074, 3117, 3126, 3143, 3224, 3313, 3356, 3442, 3595, 3625, 3643, 3662, 3807, 4116], 'sensitive': [96, 327, 3644], 'inhibition': [98, 329], 'La3+,': [100, 331], 'Gd3+,': [101, 332], 'Zn2+,': [103, 334], 'partially': [105, 336], 'inhibited': [106, 120, 176, 337, 351, 407], 'SKF96365': [108, 339], 'amiloride.': [110, 341], 'Currents': [111, 342, 2916, 3142], 'activated': [114, 345, 1501, 4476], 'bath': [116, 347, 2991, 2996, 3034, 3040, 3055, 3193, 3243, 3324, 3864, 3900, 4035, 4197, 4276, 4288, 4432, 4499], 'hypertonicity,': [117, 348], 'acid': [122, 353, 471, 1991, 2283], 'pH.': [123, 354], 'Outside-out': [124, 355, 3124], 'patches': [125, 356, 3125], 'pulled': [126, 357, 2897, 3065], 'from': [127, 207, 358, 438, 682, 2180, 2379, 2738, 2898, 3221, 3246, 3327, 3511, 3529, 3597, 3874, 3902, 3914, 4029, 4054, 4076, 4529], 'PKD1(115–226)-expressing': [128, 359], 'oocytes': [129, 145, 360, 376, 2696, 2783, 2801, 2853, 3073, 3312, 3339, 3472, 3484, 3510, 3528, 3569, 3594, 3601, 3628, 3657, 3759, 3796, 3817, 3836, 3842, 3973, 3989, 4017, 4165, 4227, 4244, 4284, 4298, 4317, 4347, 4388, 4416, 4452, 4460, 4478], 'exhibited': [130, 147, 361, 378, 4373, 4484], '5.1-fold': [132, 363], 'increased': [133, 364, 2213, 3722, 3787, 4306], 'NP': [134, 149, 365, 380], 'o': [135, 150, 366, 381], 'endogenous': [137, 368, 4523], '20-picosiemens': [138, 369], 'channels': [140, 217, 371, 448, 1445], 'linear': [142, 373], 'conductance.': [143, 374, 4011], 'PKD1(115–226)-injected': [144, 375], 'also': [146, 377, 1229, 1314, 1492, 3808, 4483], 'elevated': [148, 161, 379, 392], 'unitary': [152, 383], 'calcium': [153, 162, 384, 393, 3255, 4498], 'in': [155, 218, 386, 449, 493, 761, 1728, 1759, 1762, 1828, 1842, 1944, 1984, 2007, 2219, 2554, 2680, 2746, 2758, 2764, 2768, 2771, 2786, 2792, 2798, 2810, 2824, 2829, 2833, 2837, 2871, 3120, 3253, 3446, 3458, 3462, 3470, 3483, 3498, 3520, 3568, 3591, 3600, 3627, 3656, 3702, 3742, 3753, 3795, 3834, 3841, 3882, 3887, 3972, 4126, 4181, 4226, 4283, 4295, 4315, 4381, 4421, 4426, 4450, 4459, 4477], 'outside-out': [156, 387, 3176], 'cell-attached': [158, 389, 3122, 3207], 'patches,': [159, 390], 'permeability': [163, 394, 3027, 4015, 4486], 'documented': [164, 395], 'fluorescence': [166, 397, 3819], 'ratio': [167, 398], 'and45Ca2+': [168, 399], 'flux': [169, 400], 'experiments.': [170, 401], 'Both': [171, 402, 1079, 2200], 'Ca2+conductance': [172, 403], 'influx': [174, 405], 'La3+.': [178, 409], 'Mutation': [179, 410], 'candidate': [181, 412], 'phosphorylation': [182, 413, 1753], 'sites': [183, 414], 'within': [184, 415], 'PKD1(115–226)': [185, 416, 1228, 1313, 4482], 'abolished': [186, 417], 'current.': [189, 420], 'conclude': [191, 422], 'tail': [196, 427, 913, 950, 1064, 1491, 1507, 1718, 1888, 1917, 2140, 2154, 2259, 3620], 'up-regulates': [199, 430, 1927], 'inward': [200, 431, 1928, 3479, 3650, 3723, 3909, 3961, 4049], 'current': [201, 432, 1929, 3480, 3493, 3724, 3859, 3883, 3910, 3962, 4050, 4106, 4172, 4190, 4408, 4438, 4475], 'includes': [203, 434], 'major': [205, 436], 'contribution': [206, 437, 4521], 'nonspecific': [209, 440, 1933, 4473], 'channels.': [211, 442], 'Dysregulation': [212, 443], 'these': [214, 445, 1840, 2202, 3338, 4275], 'or': [215, 229, 446, 460, 791, 963, 1074, 1487, 1902, 2711, 2736, 2767, 3607, 3660, 3686, 3690, 3780, 4208], 'similar': [216, 447], 'disease': [223, 454, 466, 469, 487, 734, 832], 'may': [224, 455, 700, 1365], 'contribute': [225, 456], 'formation': [228, 459], 'expansion.': [230, 461, 1905], '4,4′-diisothiocyanatostilbene-2,2′-disulfonic': [470], 'siemen(s)': [472], 'amino': [473, 2282], 'acid(s)': [474], 'cystic': [475, 692], 'fibrosis': [476], 'regulator': [478, 1236], 'phosphate-buffered': [479], 'saline': [480], '∼85%': [481], '(ADPKD)1': [488], 'is': [489, 616, 627, 673, 2297], 'secondary': [490, 2811, 2860], 'mutations': [492, 833, 2553], '(PKD1)': [496], 'gene': [497], '(1Reeders': [498], 'S.T.': [499, 3427], 'Breuning': [500, 1468], 'M.H.': [501], 'Davies': [502], 'K.E.': [503], 'Nicholls': [504], 'R.D.': [505], 'Jarman': [506], 'A.P.': [507], 'Higgs': [508], 'D.R.': [509], 'Pearson': [510], 'P.L.': [511], 'Weatherall': [512], 'D.J.': [513], 'Nature.': [514, 3432], '1985;': [515], '317:': [516], '542-544Crossref': [517], 'PubMed': [518, 569, 605, 666, 722, 786, 826, 902, 933, 994, 1028, 1050, 1115, 1149, 1223, 1266, 1308, 1334, 1359, 1393, 1429, 1480, 1528, 1579, 1613, 1635, 1668, 1706, 1818, 1872, 1974, 2056, 2090, 2123, 2351, 2420, 2454, 2476, 2509, 2547, 2631, 2668, 3111, 3306, 3394, 3436, 4148, 4268, 4341, 4398], 'Scopus': [519, 570, 606, 667, 723, 787, 827, 890, 903, 934, 995, 1029, 1051, 1116, 1150, 1224, 1267, 1309, 1335, 1360, 1394, 1430, 1481, 1529, 1580, 1614, 1636, 1669, 1707, 1819, 1873, 1975, 2057, 2091, 2124, 2352, 2421, 2455, 2477, 2510, 2548, 2632, 2669, 3112, 3307, 3395, 4149, 4269, 4342, 4399], '(555)': [520], 'Google': [521, 572, 608, 669, 725, 789, 829, 864, 892, 905, 936, 997, 1031, 1053, 1118, 1152, 1226, 1269, 1311, 1337, 1362, 1396, 1432, 1483, 1531, 1582, 1616, 1638, 1671, 1709, 1821, 1859, 1875, 1977, 2059, 2093, 2126, 2354, 2423, 2457, 2479, 2512, 2550, 2634, 2671, 3114, 3309, 3397, 3437, 4151, 4271, 4344, 4401], 'Scholar).': [522, 609, 670, 830, 937, 1054, 1153, 1227, 1312, 1484, 1532, 1710, 1822, 1876, 2127, 2355, 2551, 2672, 3115, 3310, 4152, 4272, 4402], '4303-aa': [524, 1998], 'large': [529], 'extracellular': [531, 1948], 'domain': [532, 546, 576, 586, 615, 1949, 1995, 2176, 2359], 'region': [533, 841, 968, 1960], 'encompassing': [534, 961], 'leucine-rich': [535], 'repeats,': [536, 577], 'C-type': [538], 'lectin': [539], 'domain,': [540], 'low': [542], 'density': [543], 'lipoprotein': [544], 'A-like': [545], '(2Hughes': [547], 'J.': [548, 599, 780, 802, 858, 884, 980, 983, 1017, 1101, 1104, 1138, 1212, 1297, 1413, 1418, 1457, 1565, 1568, 1602, 1695, 1865, 1866, 2042, 2045, 2079, 2406, 2409, 2443, 2536, 2625, 2645, 2656, 2731, 2734, 3088, 3099, 3283, 3294, 3371, 3382, 3419, 3431, 4263, 4336], 'Ward': [549, 851], 'C.J.': [550, 852], 'Peral': [551], 'B.': [552, 766, 843, 1284, 1286, 1455, 1682, 1684, 1966, 2523, 2525, 2643, 3086, 3281, 3369, 4390], 'Aspinwall': [553], 'R.': [554, 812, 921, 1288, 1415, 1686, 2527], 'Clark': [555], 'K.': [556, 1290, 1688, 2529, 2622, 4258, 4331], 'San': [557, 844], 'Millan': [558, 845], 'J.L.': [559, 846], 'Gamble': [560, 849], 'V.': [561, 796, 850, 1382, 1405, 4141], 'Harris': [562, 855], 'P.C.': [563, 856, 895], 'Nat.': [564, 781, 1045, 1329, 1630, 2471], 'Genet.': [565, 782, 860, 886, 898, 929, 1046, 1330, 1631, 2472], '1995;': [566], '10:': [567], '151-160Crossref': [568], '(779)': [571], 'Scholar),': [573, 726, 906, 1363, 1751, 1978, 3398, 3438, 4345], '16': [574], 'PKD': [575, 831], 'single': [580, 2187, 2307], 'sperm': [581], 'receptor': [582], 'for': [583, 736, 1083, 2751, 3315, 3635, 3995, 4110, 4113, 4233], 'egg': [584], 'jelly': [585], '(3Moy': [587], 'G.W.': [588], 'Mendoza': [589], 'L.M.': [590], 'Schulz': [591], 'J.R.': [592], 'Swanson': [593], 'W.J.': [594], 'Glabe': [595], 'C.G.': [596], 'Vacquier': [597], 'V.D.': [598], 'Cell': [600, 1745, 1780, 1796], 'Biol.': [601, 984, 1018, 1105, 1139, 1213, 1298, 1419, 1524, 1569, 1603, 1696, 1746, 1781, 1797, 2046, 2080, 2410, 2444, 2537, 2657, 3100, 3295, 3383], '1996;': [602, 658, 861, 887, 930, 1477, 4265, 4338], '133:': [603], '809-817Crossref': [604], '(219)': [607], 'Following': [610, 4153], 'complex': [612, 1830, 1836], 'polytopic': [613], '226-aa': [618, 946, 2137], 'tail.': [621], 'hallmark': [623], 'pathology': [624], 'ADPKD': [626, 733, 917], 'two-hit': [629], 'generation': [630], 'gradual': [632], 'expansion': [633, 672, 749], 'cysts.': [636], 'These': [637, 2002, 2314, 3999], 'cysts': [638], 'compress': [639], 'and,': [640, 1271], 'ultimately,': [641], 'render': [642], 'nonfunctional': [643], 'adjacent,': [644], 'apparently': [645], 'normal': [646, 684], 'tissue': [648], '(4Qian': [649], 'F.': [650, 976, 1034, 1036, 1097, 1318, 1320, 1561, 1619, 1621, 2038, 2402, 2460, 2462, 4262, 4335], 'Watnick': [651], 'T.J.': [652], 'Onuchic': [653], 'L.F.': [654], 'Germino': [655, 1035, 1043, 1319, 1327, 1620, 1628, 2461, 2469], 'G.G.': [656, 1292, 1690, 2531], 'Cell.': [657, 817, 1523, 1967], '87:': [659], '979-987Abstract': [660], 'Full': [661, 663, 821, 823, 989, 991, 1023, 1025, 1110, 1112, 1144, 1146, 1218, 1220, 1303, 1305, 1424, 1426, 1574, 1576, 1608, 1610, 1701, 1703, 1971, 2051, 2053, 2085, 2087, 2415, 2417, 2449, 2451, 2542, 2544, 2663, 2665, 3106, 3108, 3301, 3303, 3389, 3391], 'Text': [662, 664, 822, 824, 990, 992, 1024, 1026, 1111, 1113, 1145, 1147, 1219, 1221, 1304, 1306, 1425, 1427, 1575, 1577, 1609, 1611, 1702, 1704, 1972, 2052, 2054, 2086, 2088, 2416, 2418, 2450, 2452, 2543, 2545, 2664, 2666, 3107, 3109, 3302, 3304, 3390, 3392], 'PDF': [665, 825, 993, 1027, 1114, 1148, 1222, 1307, 1428, 1578, 1612, 1705, 1973, 2055, 2089, 2419, 2453, 2546, 2667, 3110, 3305, 3393], '(493)': [668], 'Cyst': [671], 'associated': [674, 1536, 3476, 3708], 'with': [675, 1499, 1537, 1831, 1839, 2596, 2675, 2715, 2719, 2789, 2845, 2856, 2865, 2890, 2901, 2906, 2919, 2934, 2981, 3042, 3057, 3134, 3145, 3226, 3318, 3439, 3453, 3477, 3515, 3604, 3608, 3669, 3678, 3709, 3760, 3866, 4040, 4157, 4199, 4206, 4290, 4454, 4463, 4497], 'conversion': [677], 'tubular': [679], 'epithelial': [680], 'cells': [681, 1764], 'phenotype': [685, 693, 699], 'net': [687, 695], 'solute': [688], 'reabsorption': [689], 'secretion.': [696], 'This': [697, 2295], 'secretory': [698], 'involve': [701], 'function': [703], 'apically': [706], 'localized': [707], 'chloride': [708, 3906, 4122, 4515, 4524], 'channel,': [709], 'CFTR': [710], '(5Sullivan': [711], 'L.P.': [712], 'Wallace': [713], 'D.P.': [714], 'Grantham': [715], 'J.J.': [716], 'Physiol.': [717, 2627, 4264, 4337], 'Rev.': [718], '1998;': [719, 818, 986, 1107, 1571, 1748, 1783, 2048, 2412, 2659, 3102, 3297, 3385], '78:': [720], '1165-1191Crossref': [721], '(176)': [724], 'direct': [729, 2893], 'genes': [735], 'PKD2': [739, 792, 1486], 'mediate': [747, 1901], 'elusive,': [752], 'despite': [753], 'creation': [755], 'mouse': [757, 2722], 'lines': [758], 'genetically': [759], 'deficient': [760], '(6Lu': [763], 'W.': [764, 814, 978, 1010, 1099, 1131, 1205, 1467, 1563, 1595, 2040, 2072, 2404, 2436, 4135], 'Peissel': [765], 'Babakhanlon': [767], 'H.': [768, 810, 1517, 3421, 4133, 4254, 4327], 'Pavlova': [769], 'A.': [770, 873, 923, 925, 1262, 1355, 1389, 1403, 1465, 1664, 1739, 1774, 2119, 2347, 2505], 'Geng': [771, 1789, 1848], 'L.': [772, 974, 1004, 1014, 1095, 1125, 1135, 1199, 1209, 1243, 1251, 1282, 1340, 1372, 1515, 1559, 1589, 1599, 1645, 1653, 1680, 1790, 1849, 2036, 2066, 2076, 2100, 2108, 2328, 2336, 2400, 2430, 2440, 2486, 2494, 2521, 2614, 2641, 2649, 3084, 3092, 3279, 3287, 3367, 3375], 'Fan': [773, 1007, 1128, 1202, 1592, 2069, 2433], 'X.': [774, 1040, 1324, 1625, 1851, 2466], 'Larson': [775], 'C.': [776, 854, 1376, 1471, 1962, 2653, 3096, 3291, 3379], 'Brent': [777], 'G.': [778, 794, 800, 871, 982, 1016, 1044, 1103, 1137, 1211, 1255, 1296, 1328, 1348, 1380, 1407, 1449, 1521, 1567, 1601, 1629, 1657, 1694, 2044, 2078, 2112, 2340, 2408, 2442, 2470, 2498, 2535, 4256, 4329, 4392], 'Zhou': [779, 3430], '1997;': [783, 1047, 1331, 1356, 1632, 2473, 2628, 4395], '17:': [784], '179-181Crossref': [785], '(378)': [788], 'Scholar)': [790, 1270, 1433], '(7Wu': [793], "D'Agati": [795], 'Cai': [797, 1037, 1321, 1460, 1622, 2463], 'Y.': [798, 806, 1038, 1322, 1399, 1401, 1461, 1623, 1862, 2464, 3423], 'Markovitz': [799], 'Park': [801, 1412], 'Reynolds': [803, 1458], 'D.': [804, 1459, 1473], 'Maeda': [805, 1400], 'Le': [807], 'T.': [808, 1002, 1006, 1123, 1127, 1197, 1201, 1241, 1245, 1276, 1280, 1344, 1374, 1409, 1411, 1447, 1451, 1509, 1513, 1587, 1591, 1643, 1647, 1674, 1678, 1741, 1776, 2064, 2068, 2098, 2102, 2326, 2330, 2428, 2432, 2484, 2488, 2515, 2519], 'Hou': [809], 'Kucherlapti': [811], 'Edelman': [813], 'Somlo': [815, 1041, 1325, 1416, 1474, 1626, 2467], 'S.': [816, 867, 875, 1012, 1042, 1133, 1207, 1261, 1326, 1354, 1388, 1417, 1453, 1475, 1597, 1627, 1663, 2074, 2118, 2346, 2438, 2468, 2504, 4250, 4323], '93:': [819], '177-188Abstract': [820], '(448)': [828], 'have': [834, 951, 1544, 2320], 'been': [835, 952, 1545, 2321], 'found': [836], 'throughout': [837], 'coding': [840], '(8Peral': [842], 'Ong': [847], 'A.C.': [848], 'Strong': [853], 'Am.': [857, 883], 'Hum.': [859, 885, 896, 928], '58:': [862], '86-96PubMed': [863], 'Scholar,': [865, 893, 998, 1032, 1119, 1338, 1397, 1583, 1617, 1639, 1672, 1786, 1802, 1860, 2060, 2094, 2424, 2458, 2480, 2513, 2635], '9Rosetti': [866], 'Bresin': [868], 'E.': [869, 972, 1000, 1093, 1121, 1195, 1239, 1294, 1342, 1378, 1519, 1557, 1585, 1641, 1692, 2034, 2062, 2096, 2324, 2398, 2426, 2482, 2533, 3425], 'Restagno': [870], 'Carbonara': [872], 'Corra': [874], 'De': [876], 'Prisco': [877], 'O.': [878, 1249, 1651, 2106, 2334, 2492, 2729, 4137], 'Pignatti': [879], 'P.F.': [880], 'Turco': [881], 'A.E.': [882, 4246, 4319], '65:': [888], '155-159Crossref': [889], '(48)': [891], '10Harris': [894], 'Mol.': [897, 1522], '1999;': [899, 1020, 1141, 1215, 1263, 1390, 1421, 1525, 1605, 1665, 1799, 1815, 1856, 1869, 2082, 2120, 2348, 2446, 2506, 3433], '8:': [900], '1861-1866Crossref': [901], '(65)': [904], 'absence': [908, 4423], 'cytoplamic': [912], '(11Neophyto': [918], 'P.': [919, 1463, 3415], 'Constantinides': [920], 'Lazarou': [922], 'Pierdes': [924], 'Deltas': [926, 1470], 'C.C.': [927], '98:': [931], '437-442Crossref': [932], '(40)': [935], 'Multiple': [938], 'binding': [942, 1881], 'functions': [943, 1882], 'defined': [953], 'through': [954, 1272, 1496], 'study': [955], 'overexpressed': [957], 'proteins': [960, 1727, 1943, 2004, 2204, 3624], 'all': [962], 'portions': [964, 1987], 'this': [966, 1056, 4099], '(12Arnould': [969, 1090, 1554, 2031, 2395], 'T.E.': [970, 1091, 1555, 2032, 2396], 'Kim': [971, 1092, 1293, 1341, 1377, 1518, 1556, 1691, 2033, 2397, 2532], 'Tsokias': [973, 1094, 1558, 2035, 2399], 'Jochimsen': [975, 1096, 1560, 2037, 2401], 'Gruning': [977, 1009, 1098, 1130, 1204, 1562, 1594, 2039, 2071, 2403, 2435], 'Chang': [979, 1100, 1564, 2041, 2405], 'Walz': [981, 1015, 1102, 1136, 1210, 1254, 1295, 1347, 1379, 1520, 1566, 1600, 1656, 1693, 2043, 2077, 2111, 2339, 2407, 2441, 2497, 2534], 'Chem.': [985, 1019, 1106, 1140, 1214, 1299, 1420, 1570, 1604, 1697, 2047, 2081, 2411, 2445, 2538, 2658, 3101, 3296, 3384], '273:': [987, 1108, 1572, 2049, 2413], '6013-6018Abstract': [988, 1109, 1573, 2050, 2414], '(151)': [996, 1117, 1581, 2058, 2422], '13Kim': [999, 1120, 1584, 2061, 2425], 'Arnould': [1001, 1122, 1196, 1240, 1279, 1343, 1373, 1586, 1642, 1677, 2063, 2097, 2325, 2427, 2483, 2518], 'Sellin': [1003, 1124, 1198, 1242, 1281, 1510, 1588, 1644, 1679, 2065, 2099, 2327, 2429, 2485, 2520], 'Benzing': [1005, 1126, 1200, 1244, 1512, 1590, 1646, 2067, 2101, 2329, 2431, 2487], 'M.': [1008, 1129, 1203, 1469, 1593, 1964, 2070, 2434, 2612, 2616, 2618, 3429, 4139], 'Sokol': [1011, 1132, 1206, 1596, 2073, 2437], 'Drummond': [1013, 1134, 1208, 1598, 2075, 2439], '274:': [1021, 1142, 1216, 1422, 1606, 2083, 2447], '4947-4953Abstract': [1022, 1143, 1217, 1607, 2084, 2448], '(239)': [1030, 1151, 1225, 1615, 2092, 2456], '14Qian': [1033, 1618, 2459], 'Zhang': [1039, 1323, 1624, 2465], '16:': [1048, 1332, 1633, 2474], '179-183Crossref': [1049, 1333, 1634, 2475], '(558)': [1052, 1336, 1637, 2478], 'In': [1055, 3206, 3337, 3680, 3898, 3976, 4273], 'context,': [1059], 'activates': [1065, 1166], 'PKCα': [1066], '(in': [1068], 'process': [1070], 'requiring': [1071], 'active': [1072, 3826], 'Rac': [1073], 'Cdc-42)': [1075], 'c-Jun': [1076], 'kinase.': [1078], 'pathways': [1080, 1497], 'are': [1081, 2567, 4001], 'downstream': [1084], 'activation': [1085, 1186, 1722, 3636, 4007], 'AP-1-dependent': [1087], 'transcriptional': [1088], 'events': [1089], 'Overexpression': [1154], 'extreme': [1157], 'part': [1159], 'Wnt': [1169], 'polypeptides': [1170], 'via': [1171, 3153], 'frizzled': [1172], 'family': [1173, 1190], 'receptors': [1174], 'inhibit': [1176], 'glycogen': [1177], 'synthase': [1178], 'kinase': [1179], '3β': [1180], 'stabilize': [1182], 'β-catenin,': [1183], 'leading': [1184], 'TCF/LEF': [1189], 'transcription': [1192, 1495], 'factors': [1193], '(13Kim': [1194], 'binds': [1230], 'stabilizes': [1232, 1316], 'G': [1234], 'RGS7': [1237], '(15Kim': [1238, 2323], 'Comella': [1246, 1648, 2103, 2331, 2489], 'N.': [1247, 1649, 2104, 2332, 2490, 3417], 'Kocher': [1248, 1650, 2105, 2333, 2491], 'Tsiokas': [1250, 1514, 1652, 2107, 2335, 2493], 'Sukhatme': [1252, 1345, 1381, 1654, 2109, 2337, 2495], 'V.P.': [1253, 1655, 2110, 2338, 2496], 'Proc.': [1256, 1349, 1383, 1658, 2113, 2341, 2499], 'Natl.': [1257, 1350, 1384, 1659, 2114, 2342, 2500], 'Acad.': [1258, 1351, 1385, 1660, 2115, 2343, 2501], 'Sci.': [1259, 1352, 1386, 1661, 2116, 2344, 2502], 'U.': [1260, 1353, 1387, 1662, 2117, 2345, 2503], '96:': [1264, 1391, 1666, 2121, 2349, 2507], '6371-6376Crossref': [1265, 1667, 2122, 2350, 2508], '(145)': [1268, 1670, 2125, 2353, 2511], 'RGS7,': [1273], '14-3-3': [1274], '(16Benzing': [1275], 'Yaffe': [1277, 1675, 2516], 'M.B.': [1278, 1676, 2517], 'Schermer': [1283, 1681, 2522], 'Schilling': [1285, 1683, 2524], 'Schreiber': [1287, 1685, 2526], 'Kunzelmann': [1289, 1687, 2528, 4257, 4330], 'Leparc': [1291, 1689, 2530], '2000;': [1300, 1698, 2539], '275:': [1301, 1699, 2540], '28167-28172Abstract': [1302, 1700, 2541], '(96)': [1310, 1708, 2549], 'binds,': [1315], '(14Qian': [1317], '17Tsokias': [1339], 'U.P.': [1346], '94:': [1357], '6965-6970Crossref': [1358], '(421)': [1361], 'target': [1366], 'plasma': [1369, 3132], 'membrane': [1370, 2388, 3133], '(18Tsiokas': [1371], 'Zhu': [1375], '3934-3939Crossref': [1392], '(270)': [1395], '19Cai': [1398], 'Cedzich': [1402], 'Torres': [1404], 'Wu': [1406, 1448], 'Hayashi': [1408, 1450], 'Mochizuki': [1410], 'Witzgall': [1414], '28557-28565Abstract': [1423], '(299)': [1431], 'ADPKD2': [1435], 'gene,': [1436], 'PKD2,': [1437], 'structural': [1439], 'homolog': [1440], 'Ca2+': [1442, 4411, 4433, 4444], '(20Mochizuki': [1446], 'Xenophontos': [1452], 'Veldheusen': [1454], 'Saris': [1456], 'Gabow': [1462], 'Pierides': [1464], 'Kimberling': [1466], 'Peters': [1472], 'Science.': [1476, 4144], '272:': [1478], '1339-1342Crossref': [1479], '(1180)': [1482], 'Overexpressed': [1485], 'up-regulate': [1493], 'AP-1-mediated': [1494], 'synergistic': [1498], 'those': [1500, 3598, 3667], '(21Arnould': [1508], 'L': [1511], 'Cohen': [1516], '19:': [1526], '3423-3434Crossref': [1527], '(57)': [1530], 'activities': [1535, 1713], 'overexpression': [1538], 'fragments': [1541, 2360], 'noted': [1546], 'independent': [1547], 'type': [1549], 'membrane-anchored': [1551], '15Kim': [1640, 2095, 2481], '16Benzing': [1673, 2514], 'Additional': [1711, 3311], 'reported': [1712, 3411], 'include': [1721], 'Gαo': [1724], 'Gαi': [1726], 'vitro': [1729, 1760], '(22Parnell': [1730, 1765], 'S.C.': [1731, 1766, 1804], 'Magenheimer': [1732, 1767, 1805], 'B.S.': [1733, 1768, 1806], 'Maser': [1734, 1769, 1807], 'R.L.': [1735, 1770, 1808], 'Rankin': [1736, 1771], 'C.A.': [1737, 1772], 'Smine': [1738, 1773], 'Okamoto': [1740, 1775], 'Calvet': [1742, 1777, 1809], 'J.P.': [1743, 1778, 1810, 2647, 3090, 3285, 3373, 4260, 4333], 'Biochem.': [1744, 1779, 1795, 1811], 'Commun.': [1747, 1782, 1798, 1814], '251:': [1749, 1784], '625-631Google': [1750, 1785], 'on': [1754, 2881, 3778], 'serine': [1755], 'tyrosine': [1757], 'residues': [1758], 'transfected': [1763], '23Li': [1787], 'H.-P.': [1788], 'Burrow': [1791, 1852], 'C.R.': [1792, 1853], 'Wilson': [1793], 'P.D.': [1794, 1847], '259:': [1800, 1816], '356-363Google': [1801], '24Parnell': [1803], 'Biophys.': [1812], 'Res.': [1813], '539-543Crossref': [1817], '(36)': [1820], 'Endogenous': [1823], 'can': [1825], 'be': [1826], 'precipitated': [1827], 'E-cadherin': [1832], 'α/β/γ-catenin': [1835], 'colocalizes': [1838], 'components': [1841], 'human': [1843, 1951, 1957, 1999], 'fetal': [1844], '(25Wilson': [1846], 'Li': [1850], 'Lab.': [1854], 'Invest.': [1855, 1868], '79:': [1857], '1311-1323PubMed': [1858], '26Huan': [1861], 'van': [1863], 'Adelsberg': [1864], 'Clin.': [1867], '104:': [1870], '1459-1468Crossref': [1871], '(201)': [1874], 'varied': [1878], 'led': [1889], 'us': [1890], 'hypothesize': [1892], 'it': [1894], 'might': [1895, 4409], 'regulate': [1896, 1903], 'now': [1907], 'distal': [1911], 'fragment': [1912, 2021], '(PKD1(115–226)),': [1920], 'expressed': [1921, 2163, 2206, 3626, 3809], 'as': [1922, 2164, 2265, 2289, 3076, 3272, 3360, 3410, 3621, 4231, 4314], 'protein,': [1926], 'channel': [1935], 'oocytes.': [1938, 4183], 'cDNAs': [1939], 'encoded': [1940, 2016, 2129, 2145, 2256, 2298], 'tripartite': [1941], 'CD16': [1952, 2724, 3767, 3848], 'was': [1953, 1982, 2028, 2162, 2582, 2972, 2998, 3017, 3050, 3165, 3195, 3258, 3341, 3409, 3475, 3502, 3706, 3737, 3776, 3831, 3860, 4020, 4107, 4191, 4412, 4445, 4495, 4509], 'fused': [1954, 1983, 2361], 'CD7': [1958], '(27Romeo': [1961], 'Amiot': [1963], 'Seed': [1965], '1992;': [1968, 4145], '68:': [1969], '889-897Abstract': [1970], '(264)': [1976], 'whose': [1979], 'terminus': [1981], 'turn': [1985], '226-amino': [1990], '(aa)': [1992], 'polypeptide.': [2001], 'subcloned': [2006], 'vector,': [2011], 'pXT7.': [2012], 'longest': [2014], 'construct': [2015, 2273, 3827], 'complete': [2018], '(PKD1': [2024, 2141, 2155], 'aa': [2025, 2134, 2142, 2149, 2156, 2241, 2246, 2252], '4078–4303),': [2026], 'termed': [2029], '"CD16.7-PKD1-(1–226)"': [2030], '"CD16.7-PKD1(115–226)"': [2128], 'only': [2130, 4353], '112': [2133], '4192–4303).': [2143], '"CD16.7-PKD1(1–92)"': [2144], '92': [2148], '4078–4169).': [2157], '2In': [2158], 'most': [2159, 4002], 'experiments,': [2160, 3177, 3208], 'CD16.7-PKD1(1–92)': [2161, 3605, 3805], 'either': [2165, 2763, 3867], 'two': [2167], 'variants': [2168], 'included': [2170, 2237], 'extensions': [2172], 'beyond': [2173], 'residue': [2177], '92,': [2178], 'originating': [2179], 'polylinker': [2181], 'sequence.': [2182, 2271], 'One': [2183], 'form': [2184, 2193, 2225], 'added': [2185, 2194, 4042], 'Ser': [2189], 'residue.': [2190], 'other': [2192, 2316], '7-residue': [2196], 'sequence': [2198, 2284, 2292, 2296], 'Ser-Ala-Ala-Ala-Arg-Glu-Ile.': [2199], 'surface,': [2210], 'neither': [2212], 'currents.': [2215, 3696, 4525], 'experiment': [2217], 'shown': [2218, 3701, 3752], 'Fig.': [2220, 3543, 3703, 4502], '6': [2221, 4084], 'D': [2222, 3673, 3705], 'utilized': [2223, 2945], 'CD16.7-PKD(1–92)': [2227], 'devoid': [2228], 'any': [2230], 'extension.': [2232], 'Other': [2233], 'constructs': [2235, 2319, 2383, 3700, 3806], 'studied': [2236, 4496], '"CD16.7-PKD1(1–155)"': [2238], '4078–4232,': [2242], '"CD16.7-PKD1(115–189)"': [2243], '4192–4266,': [2247], '"CD16.7-PKD1(115–203)"': [2249], '4192–4280.': [2253], '"CD16.7': [2254], 'control"': [2255], 'same': [2263, 2287, 2381], 'length': [2264, 2288], 'PKD1(1–92),': [2266], 'unrelated,': [2269], 'novel': [2270], '3The': [2272], 'CD16.7': [2274, 2364, 3486, 3522, 3571, 3592, 3684, 3735, 3782, 4229, 4296], 'control': [2275, 3487, 3523, 3572, 3736], 'provides': [2276], 'novel,': [2278], 'PKD1(1–92)-unrelated': [2279], 'PKD1(1–92).': [2290], 'is:': [2293], 'ESWHLSPLLCVGLWALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLWMGLSKVKES.': [2294], 'frameshifted': [2301], 'PKD1(1–92)': [2302], 'cDNA': [2303], '(due': [2304], 'nucleotide': [2308, 2312], 'deletion,': [2309], 'GenBank™': [2310], 'NM000296': [2311], '12446).': [2313], 'CD16.7-PKD1': [2317, 3622], 'wild-type': [2318], 'described': [2322, 3077, 3273, 3361], 'anchor': [2366], 'display': [2367], 'intracellular': [2368, 3254, 4121], 'binding,': [2370], 'signaling,': [2371], '293T': [2373], 'properties': [2377], 'indistinguishable': [2378, 2866, 3596], 'linked': [2384], 'immunoglobulin': [2386], 'ectodomain': [2387], 'anchors': [2389], 'various': [2392], 'epitope': [2393, 3775, 3849], 'tags': [2394], 'Point': [2552], 'CD16.7-PKD1(115–226)': [2555, 3474, 3500, 3670, 3731, 3779, 4019, 4167], 'constructed': [2557], 'four': [2559], 'primer': [2560], 'polymerase': [2561, 2574], 'chain': [2562, 2575], 'reaction': [2563, 2576], 'techniques.': [2564], 'Primer': [2565], 'sequences': [2566], 'available': [2568], 'upon': [2569], 'request.': [2570], 'Integrity': [2571], 'products': [2577], 'ligation': [2580], 'junctions': [2581], 'confirmed': [2583], 'DNA': [2585], 'sequencing.': [2586], 'Sal': [2587], 'I-': [2588], 'orNot': [2589], 'I-linearized': [2590], 'recombinant': [2591], 'pXT7': [2592], 'templates': [2593], 'transcribed': [2595], 'T7': [2597], 'RNA': [2598], 'polymerase.': [2599], 'isolation,': [2602], 'culture,': [2603], 'microinjection': [2605], 'performed': [2607], 'using': [2608, 3399], 'standard': [2609], 'techniques': [2610], '(28Chernova': [2611], 'Jiang': [2613, 2640, 3083, 3278, 3366], 'Crest': [2615], 'Hand': [2617], 'Vandorpe': [2619], 'D.H.': [2620, 2637, 3080, 3275, 3363], 'Strange': [2621], 'Alper': [2623, 2654, 3097, 3292, 3380], 'S.L.': [2624, 2655, 3098, 3293, 3381], 'Gen.': [2626], '109:': [2629], '345-360Crossref': [2630], '(82)': [2633], '29Vandorpe': [2636], 'Shmukler': [2638, 3081, 3276, 3364], 'B.E.': [2639, 3082, 3277, 3365], 'Lim': [2642, 3085, 3280, 3368], 'Maylie': [2644, 3087, 3282, 3370], 'Adelman': [2646, 3089, 3284, 3372], 'Francheschi': [2648, 3091, 3286, 3374], 'Cappellini': [2650, 3093, 3288, 3376], 'M.D.': [2651, 3094, 3289, 3377], 'Brugnara': [2652, 3095, 3290, 3378], '273': [2660, 3103, 3298, 3386], '(21533):': [2661, 3104, 3299, 3387], '21542Abstract': [2662, 3105, 3300, 3388], '(175)': [2670, 3113, 3308, 3396], 'Oocytes': [2673, 2707, 2760, 2806, 2868, 3220, 3441, 4115], 'injected': [2674, 2708, 3225, 3603, 3816, 4462], '12–25': [2676], 'ng': [2677], 'cRNA': [2679, 2716, 3606, 3719, 3792], 'volume': [2682], '50': [2684, 2795], 'nl': [2685], 'maintained': [2686], 'integrity': [2687], 'up': [2688], '18': [2690, 3512], 'days': [2691, 2704, 2713, 3717], 'after': [2692, 2705, 3718, 3791], 'injection.': [2693, 3720], 'Generally,': [2694], 'however,': [2695], 'subjected': [2698, 3241, 3322], 'electrical': [2700], 'recording': [2701], 'studies': [2702], '2–3': [2703, 2914], 'microinjection.': [2706], '3,': [2709], '5,': [2710, 3952, 4310], '10': [2712, 3189, 3200, 3203, 3214, 3218, 3249, 3335, 4430], 'previously': [2714, 3078, 3602, 4461], 'incubated': [2718, 2809, 2855, 3443], 'purified': [2720], '3G8': [2721], 'anti-human': [2723], 'monoclonal': [2725], 'antibody': [2726, 2861, 3762], '(gift': [2727], 'Mandelstam,': [2730], 'Strominger,': [2732], 'Unkeless;': [2735], 'purchased': [2737], 'Meditech)': [2739], 'concentration': [2742, 3236, 3256], '2': [2744, 3002, 3851], 'μg/ml': [2745], 'ND96': [2747], 'room': [2749], 'temperature': [2750], '3–4': [2752], 'h,': [2753], 'then': [2754, 2797, 2808, 2831, 3240, 3321, 3460, 4117, 4425], 'rinsed': [2755, 2785, 2826], 'times': [2757, 2828, 3790], 'ND96.': [2759], 'fixed': [2762], 'absolute': [2765], 'methanol': [2766], '3%': [2769], 'paraformaldehyde': [2770], '140': [2772, 3196], 'mm': [2773, 2776, 3000, 3005, 3008, 3012, 3185, 3197, 3201, 3204, 3215, 3329, 3333, 4031, 4038, 4431], 'NaCl,': [2774, 3001, 4039], '20': [2775], 'sodium': [2777, 3198, 3868, 3877, 4129], 'phosphate,': [2778], 'pH': [2779, 3024], '7.4': [2780], '(PBS).': [2781], 'Paraformaldehyde-fixed': [2782], 'PBS,': [2787, 2825, 2830], 'quenched': [2788], 'washes': [2791], 'PBS': [2793], 'plus': [2794], 'mmglycine,': [2796], 'PBS.': [2799, 2805], 'Methanol-fixed': [2800], 'rehydrated': [2803], 'into': [2804], 'Cy3-conjugated': [2812], 'donkey': [2813], 'anti-mouse': [2814], 'IgG': [2815], '(Jackson': [2816], 'Immunoresearch': [2817], 'Laboratories,': [2818], 'West': [2819], 'Grove,': [2820], 'PA)': [2821], 'diluted': [2822], '1/500': [2823], 'dehydrated': [2832], 'methanol,': [2834], 'cleared': [2836], 'benzyl': [2838], 'benzoate/benzyl': [2839], 'alcohol': [2840], '(2:1)': [2841], 'prior': [2842, 2862], 'imaging': [2844, 3268], 'Bio-Rad': [2847], 'MRC': [2848], '1024': [2849], 'confocal': [2850], 'microscope.': [2851], 'Some': [2852], 'both': [2857, 3222, 3798], 'primary': [2858], 'fixation,': [2864], 'results.': [2867], 'placed': [2870], '1-ml': [2873], 'chamber': [2874], '(model': [2875], 'RC-11,': [2876], 'Warner': [2877], 'Instruments,': [2878, 2925], 'Hamden,': [2879], 'CT)': [2880], 'stage': [2883], 'dissecting': [2886], 'microscope': [2887], 'impaled': [2889], 'microelectrodes': [2891], 'under': [2892], 'view.': [2894], 'Electrodes': [2895], 'borosilicate': [2899], 'glass': [2900], 'Narashige': [2903], 'puller,': [2904], 'filled': [2905, 2980], '3': [2907, 2982, 4174, 4215, 4220, 4357], 'm': [2908, 2983], 'KCl,': [2909, 2984, 4200], 'had': [2911], 'resistances': [2912], 'megohms.': [2915], 'measured': [2918, 3144, 3494, 3599], 'Geneclamp': [2921], '500': [2922], 'amplifier': [2923, 3149], '(Axon': [2924, 2939, 2949, 3150], 'Burlingame,': [2926], 'CA)': [2927], 'interfaced': [2928, 3152], 'Hewlett': [2931], 'Packard': [2932], 'computer': [2933], 'Digidata': [2936, 3155], '1200': [2937, 3156], 'interface': [2938], 'Instruments).': [2940, 2950], 'Data': [2941, 3164], 'acquisition': [2942], 'analysis': [2944], 'pCLAMP': [2946], '6.0.3': [2947], 'software': [2948, 3403], 'Voltage': [2951], 'pulse': [2952, 3136], 'protocols': [2953], 'consisting': [2954], '720-ms': [2956], '20-mV': [2957], 'steps': [2958], '−100': [2960, 3496, 3654, 3912, 3964, 4052, 4440], '+20': [2962], 'mV': [2963, 3497, 3564, 3567, 3655, 3913, 3934, 3946, 3965, 4053, 4080, 4085, 4216, 4303, 4358, 4441], 'generated': [2965], 'Clampex': [2968], 'subroutine.': [2969], 'Bath': [2970, 3872, 4204], 'resistance': [2971, 3068], 'minimized': [2973], 'use': [2976], 'agar': [2978], 'bridges': [2979], 'virtual': [2987], 'ground': [2988], 'circuit': [2989], 'clamped': [2990], 'zero.': [2994], 'Standard': [2995], 'solution': [2997, 3194], '96': [2999, 4030], 'mmKCl,': [3003], '5': [3004, 3173, 3933], 'HEPES,': [3006, 3216], '1.8': [3007, 3328], 'CaCl2,': [3009], '1': [3011, 3168, 3444, 3544, 3577, 3611, 3672, 3704, 3892, 3945], 'MgCl2,': [3013], 'holding': [3015, 4493, 4506], '−30': [3018, 4510], 'All': [3020], 'solutions': [3021, 3179], '7.40.': [3025], 'Cation/anion': [3026], 'determinations': [3028], 'equimolar': [3031, 3052, 4194], 'replacement': [3032], 'Na+': [3035, 3056], 'withN-methyl-d-glucamine': [3036], '(NMDG),': [3037], 'Cl−': [3041, 3996, 4163], 'gluconate.': [3043], 'Determination': [3044], 'relative': [3046, 4013], 'monovalent': [3047, 4377], 'permeabilities': [3049], 'substitution': [3053, 3865, 4195, 4205, 4289, 4500], 'K+,': [3058], 'Li+,': [3059], 'NH4−.': [3061], 'Patch': [3062], 'pipettes': [3063], '5–8': [3070], 'megohms,': [3071], 'devitellinized': [3075], '(29Vandorpe': [3079, 3274, 3362], 'Gigaseals': [3116], 'first': [3118, 4420], 'attained': [3119], 'mode.': [3123], 'formed': [3127], 'breaking': [3129], 'withdrawing': [3138], 'pipette': [3140, 3178, 3210], 'slowly.': [3141], 'an': [3146, 3478, 4530], 'Axopatch': [3147], '1D': [3148], 'Instruments)': [3151], 'AD/DA': [3157], 'board': [3158], 'HP': [3161], 'Vectra': [3162], 'computer.': [3163], 'acquired': [3166, 3357], 'kHz': [3169], 'digitized': [3171], 'kHz.': [3174], 'For': [3175], 'contained': [3180, 3211], '128': [3181], 'mmcesium': [3182], 'aspartate,': [3183], '12': [3184], 'cesium': [3186], 'EGTA,': [3187], 'mmHEPES': [3190], 'methanesulfonate,': [3199], 'HEDTA,': [3202], 'HEPES.': [3205], '100': [3212], 'mmCaCl2,': [3213], 'mmHEDTA.': [3219], 'groups': [3223], '70-kDa': [3227], 'Calcium': [3228], 'Green': [3229], 'dextran': [3230], '(Molecular': [3231], 'Probes)': [3232], 'final': [3235], '3.5–7': [3238], 'μm,': [3239], '[Ca2+]': [3244, 3325], 'change': [3245, 3252, 3873, 3886, 3901], '0': [3247, 3332], 'mm.': [3250, 3336], 'Relative': [3251], '([Ca2+]i)': [3257], 'determined': [3259, 3342], 'exciting': [3261, 3345], 'fluorophore': [3263, 3347], '490': [3265], 'nm': [3266, 3271], '530': [3270], 'loaded': [3314], '45': [3316], 'min': [3317], '8': [3319], 'μmFura2-AM,': [3320], 'changes': [3326, 4277], 'nominal': [3331], '[Ca2+]i': [3340], 'alternately': [3344], '340': [3349], '380': [3351], 'nm.': [3352], '510-nm': [3353], 'emission': [3354], 'images': [3355], 'analyzed': [3359], 'IMAGE1': [3400], 'IMAGE1-FL': [3402], '(Universal': [3404], 'Imaging).': [3405], 'uptake': [3407], 'procedure': [3408], '(30Chen': [3412], 'X.Z.': [3413], 'Vassilev': [3414], 'Basora': [3416], 'Peng': [3418], 'Nomura': [3420], 'Segal': [3422], 'Brown': [3424], 'Reeders': [3426], 'Hediger': [3428], '401:': [3434], '383-386Crossref': [3435], 'modifications.': [3440], 'h': [3445], 'ND-96': [3447], 'modified': [3448], 'contain': [3450], '0.13': [3451], 'mmCaCl2': [3452], '2.5': [3454], 'μCi/μl': [3455], '45Ca2+,': [3456], 'washed': [3457], 'ND-96,': [3459], 'counted': [3461], 'liquid': [3464], 'scintillation': [3465], 'counter': [3466], '(Packard': [3467], '2200CA).': [3468], 'Expression': [3469, 3697], 'observed': [3482, 3668, 3971, 4180], 'expressing': [3485, 3570, 3658, 3843, 3974, 4018, 4166, 4228, 4285, 4532], '(Fig.1,': [3488], 'A': [3489], 'B).': [3491, 4504], 'group': [3501, 3524], '−910': [3503], '±': [3504, 3517, 3891, 3916, 3921, 3932, 3944, 3958, 4056, 4060, 4078, 4083, 4214, 4219, 4301, 4356, 4447, 4456], '68': [3505], 'nA': [3506, 3519, 3918, 3960, 4062, 4449, 4458], '(n': [3507, 3525, 3935, 4223, 4308, 4359], '=': [3508, 3526, 3533, 3894, 3936, 3951, 3967, 3969, 4064, 4066, 4087, 4090, 4224, 4309, 4360, 4363, 4365, 4466], '97': [3509], 'frogs)': [3513], 'compared': [3514, 4453], '−131': [3516], '11': [3518], '79': [3527], '15': [3530], 'frogs,': [3531], 't': [3532, 3541, 3584, 3954, 4070, 4094, 4469], '10.2,': [3534], 'p': [3535, 3924, 4089], '<': [3536, 3587, 3925, 3949], '0.0001': [3537], 'unpaired': [3539, 3583, 3953], 'two-tailed': [3540, 4069, 4468], 'test,': [3542], 'C).': [3545], 'average': [3547], 'conductances': [3548], '2.1': [3550], '8.7': [3552], 'μS': [3553], 'whole': [3556], 'potentials': [3559, 3994], '−31': [3563], '+2': [3566], 'CD16.7-PKD1(115–226),': [3574], 'respectively': [3575, 4222], '(Fig.': [3576, 3610, 3671, 3850, 4173], 'C),': [3578], 'each': [3579, 3938], 'differed': [3580], 'significantly': [3581, 3907, 3939, 4176, 4305], 'tests': [3585], '(p': [3586, 3948, 3966, 4465], '0.0001).': [3588], 'control-expressing': [3593, 4297], 'water': [3609, 4464], 'D).': [3612], 'Several': [3613], 'subdomains': [3614], 'further': [3629, 4021], 'delimit': [3631], 'regions': [3633], '(Fig.1': [3640], 'D),': [3641], 'block': [3646], 'La3+(inset).': [3648], 'La3+-sensitive': [3649, 4171], 'elicited': [3652, 3729], 'CD16.7-PKD1(115–203)': [3659], '-(115–189)': [3661], 'magnitude': [3664, 4382], 'comparable': [3665, 3764, 3821], 'data': [3675, 4311, 4367], 'shown)': [3677, 3839, 4313], 'CD16.7-PKD1(1–226).': [3679], 'contrast,': [3681, 3899, 4274], 'control,': [3685, 4230], 'CD16.7-PKD1(1–92),': [3688], '(),': [3689], '()': [3691], 'did': [3692, 4278], 'induce': [3694], 'such': [3695], 'evident': [3710], 'morbidity': [3712], 'over': [3713], 'least': [3715], '4': [3716, 4079, 4302, 4503], 'positive': [3726], 'voltage-shiftedE': [3727], 'rev': [3728, 3889, 3930, 3986, 4075, 4102, 4211, 4282, 4294, 4352], 'explained': [3739, 4004], 'differences': [3741], 'different': [3748], 'proteins.': [3750], 'As': [3751], 'Fig.2,': [3754], 'immunostaining': [3755], 'intact,': [3757], 'unfixed': [3758], 'anti-CD16': [3761], 'revealed': [3763], 'intensities': [3765, 3820], 'signal': [3768], 'whether': [3773], 'borne': [3777], 'control.': [3783], 'Surface': [3784, 3829], 'staining': [3785, 3830], 'intensity': [3786], 'longer': [3789], 'injection': [3793, 4156], 'coexpressing': [3797], 'cRNAs': [3799], '(data': [3800, 3837], 'shown).': [3802, 4369], 'inactive': [3804], '57%': [3814], 'CD16.7-PKD1(115–226).': [3828, 4286], 'always': [3832], 'absent': [3833], 'water-injected': [3835], 'CFTR,': [3844], 'lacks': [3846], 'd).': [3852], 'selectivity': [3855, 4186], 'CD16.7-PKD1(115–226)-associated': [3858, 4371], 'tested': [3861, 4022, 4192, 4413], 'NaCl': [3863, 3875, 3903, 4032, 4198], 'gluconate': [3869, 3878], 'orN-methyl-d-glucamine': [3870], 'chloride.': [3871], 'produced': [3879], 'little': [3880, 4374], 'reduction': [3881], 'no': [3885], 'E': [3888, 3929, 4074, 4281, 4293, 4351], '(−1': [3890], 'mV,n': [3893], '15,': [3895], 'Fig.3': [3896], 'A).': [3897, 4435], 'N-methyl-d-glucamine': [3905], 'decreased': [3908, 4048], '−573': [3915], '58': [3917], '−327': [3920], '52': [3922], 'nA,': [3923], '0.001),': [3926], 'hyperpolarized': [3928, 4073], '−19': [3931, 4082], '15),': [3937], 'greater': [3940, 4177], 'than': [3941, 4112, 4178], '−5': [3943], 'hyperpolarization': [3947], '0.001,n': [3950], 'test),': [3955, 4071], '−99': [3957], '13': [3959], '0.0019,n': [3968], '5)': [3970], 'CD16.7(control).': [3975], 'presence': [3978, 4428], 'impermeant': [3981], 'NMDG,': [3983], 'depolarizedE': [3985, 4210], 'CD16.7-PKD1(115–226)-expressing': [3988, 4346, 4451], 'shifts': [3990], 'toward': [3991], 'equilibrium': [3993, 4516], 'K+.': [3998], 'results': [4000], 'simply': [4003], 'preferential': [4006], 'anion/cation': [4014], 'mannitol': [4025, 4041], 'dilution': [4026], 'test.': [4027], 'Shifting': [4028], 'containing': [4036], '9.6': [4037], 'maintain': [4044], 'constant': [4045], 'osmotic': [4046], 'strength,': [4047], '−634': [4055], '155': [4057], '−464': [4059], '130': [4061], '(t': [4063, 4086], '5.5,p': [4065], '0.0009,': [4067], '−11': [4077], '4.1,': [4088], '0.005,': [4091], 'paired': [4093], 'test).': [4095, 4470], 'direction': [4097], 'shift': [4100], 'inE': [4101], 'indicates': [4103], 'CD16.7-PKD1(115–226)-stimulated': [4105], 'more': [4108], 'selective': [4109], 'cations': [4111], 'anions.': [4114], '∼90%': [4118], 'depleted': [4119], 'overnight': [4124], 'incubation': [4125], 'Cl-free': [4128], 'methanesulfonate': [4130], 'medium': [4131], '(31Hasegawa': [4132], 'Skach': [4134], 'Baker': [4136], 'Calayag': [4138], 'Ligappa': [4140], 'Verkman': [4142], 'A.S.': [4143], '258:': [4146], '1477-1479Crossref': [4147], '(125)': [4150], 'subsequent': [4154], 'acute': [4155], 'EGTA': [4158], 'minimize': [4160, 4519], 'residual': [4161], 'Ca2+-activated': [4162], 'currents,': [4164], 'continued': [4168], 'exhibit': [4170], 'B)': [4175], 'PKD1(1–92)fs-expressing': [4182], 'Monovalent': [4184], 'LiCl,': [4201], 'NH4Cl.': [4203], 'KCl': [4207], 'LiCl': [4209], '+15': [4213], '+7': [4218], 'mV,': [4221, 4511], '5),': [4225], 'expected': [4232], 'moderate': [4235], 'K+': [4236], 'conductance': [4237, 4241, 4307, 4386], 'small': [4239], 'native': [4242, 4316, 4384], '(32Busch': [4245, 4318], 'Kopp': [4247, 4320], 'H.G.': [4248, 4321], 'Waldegger': [4249, 4322], 'Samarzija': [4251, 4324], 'I.': [4252, 4325], 'Subbrich': [4253, 4326], 'Raber': [4255, 4328], 'Ruppersberg': [4259, 4332], 'Lang': [4261, 4334], '491:': [4266, 4339], '735-741Crossref': [4267, 4340], '(27)': [4270, 4343], 'alter': [4280], 'Whereas': [4287], 'NH4Cl': [4291], 'depolarized': [4292], '+41': [4300], '(extrapolated)': [4350], 'slightly,': [4354], '+6': [4355], '6;': [4361], 'F': [4362], '5.7,p': [4364], '0.02,': [4366], 'Thus,': [4370, 4471], 'specificity': [4375], 'among': [4376], 'cations,': [4378], 'approximated': [4380], 'NH4+': [4385], '(33Burckhardt': [4389], 'Burckhardt': [4391], 'Pflugers': [4393], 'Arch.': [4394], '434:': [4396], '306-312Crossref': [4397], '(33)': [4400], 'hypothesis': [4404], 'PKD1(115–226)-associated': [4407], 'conduct': [4410], 'subjecting': [4415], 'voltage': [4418], 'ramps': [4419], '(Fig.4': [4434], 'difference': [4437], 'attributable': [4442], '−436': [4446], '95': [4448], '+21': [4455], '27': [4457], '0.004,': [4467], 'substantial': [4485], 'Ca2+.': [4488], 'time': [4490], 'course': [4491], '(see': [4501], 'chosen': [4508], 'close': [4512], 'potential,': [4517], 'upper': [4527], 'trace': [4528], 'CD16.7-PKD1(115': [4533]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2090050973', 'counts_by_year': [{'year': 2022, 'cited_by_count': 3}, {'year': 2021, 'cited_by_count': 1}, {'year': 2020, 'cited_by_count': 1}, {'year': 2018, 'cited_by_count': 2}, {'year': 2015, 'cited_by_count': 3}, {'year': 2013, 'cited_by_count': 1}, {'year': 2012, 'cited_by_count': 3}], 'updated_date': '2025-01-09T13:43:24.268592', 'created_date': '2016-06-24'}