Publication Information

{'id': 'https://openalex.org/W2082015870', 'doi': 'https://doi.org/10.7326/0003-4819-88-3-361', 'title': 'Neurologic Toxicity Associated with High-Dose Metronidazole Therapy', 'display_name': 'Neurologic Toxicity Associated with High-Dose Metronidazole Therapy', 'publication_year': 1978, 'publication_date': '1978-03-01', 'ids': {'openalex': 'https://openalex.org/W2082015870', 'doi': 'https://doi.org/10.7326/0003-4819-88-3-361', 'mag': '2082015870', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/629500'}, 'language': 'en', 'primary_location': {'is_oa': False, 'landing_page_url': 'https://doi.org/10.7326/0003-4819-88-3-361', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S119722071', 'display_name': 'Annals of Internal Medicine', 'issn_l': '0003-4819', 'issn': ['0003-4819', '1539-3704'], 'is_oa': False, 'is_in_doaj': False, 'is_core': True, 'host_organization': 'https://openalex.org/P4310316812', 'host_organization_name': 'American College of Physicians', 'host_organization_lineage': ['https://openalex.org/P4310316812'], 'host_organization_lineage_names': ['American College of Physicians'], 'type': 'journal'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': False, 'oa_status': 'closed', 'oa_url': None, 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5074002894', 'display_name': 'Stephen Frytak', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1330342723', 'display_name': 'Mayo Clinic', 'ror': 'https://ror.org/02qp3tb03', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1330342723']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Stephen Frytak', 'raw_affiliation_strings': ['Mayo Clinic Rochester-MN'], 'affiliations': [{'raw_affiliation_string': 'Mayo Clinic Rochester-MN', 'institution_ids': ['https://openalex.org/I1330342723']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5108786744', 'display_name': 'Charles G. Moertel', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1330342723', 'display_name': 'Mayo Clinic', 'ror': 'https://ror.org/02qp3tb03', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1330342723']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Charles G. Moertel', 'raw_affiliation_strings': ['Mayo Clinic Rochester-MN'], 'affiliations': [{'raw_affiliation_string': 'Mayo Clinic Rochester-MN', 'institution_ids': ['https://openalex.org/I1330342723']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5110160209', 'display_name': 'Donald S. Childs', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1330342723', 'display_name': 'Mayo Clinic', 'ror': 'https://ror.org/02qp3tb03', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I1330342723']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Donald S. Childs', 'raw_affiliation_strings': ['Mayo Clinic, and Mayo Foundation, Rochester, Minnesota'], 'affiliations': [{'raw_affiliation_string': 'Mayo Clinic, and Mayo Foundation, Rochester, Minnesota', 'institution_ids': ['https://openalex.org/I1330342723']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5109546616', 'display_name': 'James W. Albers', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I204308271', 'display_name': 'Medical College of Wisconsin', 'ror': 'https://ror.org/00qqv6244', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I204308271']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'James W. Albers', 'raw_affiliation_strings': ['Medical College of Wisconsin; Milwaukee; Wisconsin'], 'affiliations': [{'raw_affiliation_string': 'Medical College of Wisconsin; Milwaukee; Wisconsin', 'institution_ids': ['https://openalex.org/I204308271']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': None, 'apc_paid': None, 'fwci': 1.571, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 124, 'citation_normalized_percentile': {'value': 0.988372, 'is_in_top_1_percent': False, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 97, 'max': 98}, 'biblio': {'volume': '88', 'issue': '3', 'first_page': '361', 'last_page': '361'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T12055', 'display_name': 'Boron Compounds in Chemistry', 'score': 0.999, 'subfield': {'id': 'https://openalex.org/subfields/2741', 'display_name': 'Radiology, Nuclear Medicine and Imaging'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, 'topics': [{'id': 'https://openalex.org/T12055', 'display_name': 'Boron Compounds in Chemistry', 'score': 0.999, 'subfield': {'id': 'https://openalex.org/subfields/2741', 'display_name': 'Radiology, Nuclear Medicine and Imaging'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, {'id': 'https://openalex.org/T10129', 'display_name': 'Glioma Diagnosis and Treatment', 'score': 0.9989, 'subfield': {'id': 'https://openalex.org/subfields/2716', 'display_name': 'Genetics'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, {'id': 'https://openalex.org/T13201', 'display_name': 'Infectious Encephalopathies and Encephalitis', 'score': 0.9968, 'subfield': {'id': 'https://openalex.org/subfields/2725', 'display_name': 'Infectious Diseases'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/radiosensitizer', 'display_name': 'Radiosensitizer', 'score': 0.79646456}], 'concepts': [{'id': 'https://openalex.org/C2777396551', 'wikidata': 'https://www.wikidata.org/wiki/Q169569', 'display_name': 'Metronidazole', 'level': 3, 'score': 0.90856874}, {'id': 'https://openalex.org/C71924100', 'wikidata': 'https://www.wikidata.org/wiki/Q11190', 'display_name': 'Medicine', 'level': 0, 'score': 0.8778491}, {'id': 'https://openalex.org/C2776428644', 'wikidata': 'https://www.wikidata.org/wiki/Q2126468', 'display_name': 'Radiosensitizer', 'level': 3, 'score': 0.79646456}, {'id': 'https://openalex.org/C2780852908', 'wikidata': 'https://www.wikidata.org/wiki/Q127076', 'display_name': 'Vomiting', 'level': 2, 'score': 0.66222054}, {'id': 'https://openalex.org/C2780580376', 'wikidata': 'https://www.wikidata.org/wiki/Q186889', 'display_name': 'Nausea', 'level': 2, 'score': 0.61814445}, {'id': 'https://openalex.org/C29730261', 'wikidata': 'https://www.wikidata.org/wiki/Q274160', 'display_name': 'Toxicity', 'level': 2, 'score': 0.57538766}, {'id': 'https://openalex.org/C509974204', 'wikidata': 'https://www.wikidata.org/wiki/Q180507', 'display_name': 'Radiation therapy', 'level': 2, 'score': 0.5636057}, {'id': 'https://openalex.org/C90924648', 'wikidata': 'https://www.wikidata.org/wiki/Q120569', 'display_name': 'Gastroenterology', 'level': 1, 'score': 0.4510847}, {'id': 'https://openalex.org/C126322002', 'wikidata': 'https://www.wikidata.org/wiki/Q11180', 'display_name': 'Internal medicine', 'level': 1, 'score': 0.4291796}, {'id': 'https://openalex.org/C2989005', 'wikidata': 'https://www.wikidata.org/wiki/Q214963', 'display_name': 'Nuclear medicine', 'level': 1, 'score': 0.4076498}, {'id': 'https://openalex.org/C98274493', 'wikidata': 'https://www.wikidata.org/wiki/Q128406', 'display_name': 'Pharmacology', 'level': 1, 'score': 0.32549584}, {'id': 'https://openalex.org/C501593827', 'wikidata': 'https://www.wikidata.org/wiki/Q12187', 'display_name': 'Antibiotics', 'level': 2, 'score': 0.20931983}, {'id': 'https://openalex.org/C89423630', 'wikidata': 'https://www.wikidata.org/wiki/Q7193', 'display_name': 'Microbiology', 'level': 1, 'score': 0.0}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.0}], 'mesh': [{'descriptor_ui': 'D008795', 'descriptor_name': 'Metronidazole', 'qualifier_ui': 'Q000008', 'qualifier_name': 'administration & dosage', 'is_major_topic': True}, {'descriptor_ui': 'D008795', 'descriptor_name': 'Metronidazole', 'qualifier_ui': 'Q000009', 'qualifier_name': 'adverse effects', 'is_major_topic': True}, {'descriptor_ui': 'D008795', 'descriptor_name': 'Metronidazole', 'qualifier_ui': 'Q000627', 'qualifier_name': 'therapeutic use', 'is_major_topic': True}, {'descriptor_ui': 'D012640', 'descriptor_name': 'Seizures', 'qualifier_ui': 'Q000139', 'qualifier_name': 'chemically induced', 'is_major_topic': True}, {'descriptor_ui': 'D000230', 'descriptor_name': 'Adenocarcinoma', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000230', 'descriptor_name': 'Adenocarcinoma', 'qualifier_ui': 'Q000188', 'qualifier_name': 'drug therapy', 'is_major_topic': False}, {'descriptor_ui': 'D000368', 'descriptor_name': 'Aged', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000818', 'descriptor_name': 'Animals', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004285', 'descriptor_name': 'Dogs', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D005260', 'descriptor_name': 'Female', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006801', 'descriptor_name': 'Humans', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008795', 'descriptor_name': 'Metronidazole', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008875', 'descriptor_name': 'Middle Aged', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009362', 'descriptor_name': 'Neoplasm Metastasis', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D012640', 'descriptor_name': 'Seizures', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013274', 'descriptor_name': 'Stomach Neoplasms', 'qualifier_ui': 'Q000188', 'qualifier_name': 'drug therapy', 'is_major_topic': False}, {'descriptor_ui': 'D013274', 'descriptor_name': 'Stomach Neoplasms', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': False, 'landing_page_url': 'https://doi.org/10.7326/0003-4819-88-3-361', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S119722071', 'display_name': 'Annals of Internal Medicine', 'issn_l': '0003-4819', 'issn': ['0003-4819', '1539-3704'], 'is_oa': False, 'is_in_doaj': False, 'is_core': True, 'host_organization': 'https://openalex.org/P4310316812', 'host_organization_name': 'American College of Physicians', 'host_organization_lineage': ['https://openalex.org/P4310316812'], 'host_organization_lineage_names': ['American College of Physicians'], 'type': 'journal'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/629500', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': None, 'sustainable_development_goals': [{'display_name': 'Good health and well-being', 'score': 0.63, 'id': 'https://metadata.un.org/sdg/3'}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 4, 'referenced_works': ['https://openalex.org/W2040829577', 'https://openalex.org/W2060688340', 'https://openalex.org/W2319463151', 'https://openalex.org/W29345286'], 'related_works': ['https://openalex.org/W4232799063', 'https://openalex.org/W2765896093', 'https://openalex.org/W2375265431', 'https://openalex.org/W2330828714', 'https://openalex.org/W2051037277', 'https://openalex.org/W2033508602', 'https://openalex.org/W2030053732', 'https://openalex.org/W2005374976', 'https://openalex.org/W148728087', 'https://openalex.org/W111787504'], 'abstract_inverted_index': {'Brief': [0], 'Reports1': [1], 'March': [2, 840, 852], '1978Neurologic': [3], 'Toxicity': [4, 116, 620, 810], 'Associated': [5, 770, 811], 'with': [6, 85, 100, 112, 322, 337, 440, 480, 502, 661, 665, 676, 764, 771, 812], 'High-Dose': [7], 'Metronidazole': [8, 398, 556, 588, 677, 765, 813], 'TherapySTEPHEN': [9], 'FRYTAK,': [10, 26], 'M.D.,': [11, 15, 20, 24, 27, 31, 36, 40, 671, 698, 817, 821, 825], 'CHARLES': [12, 28], 'G.': [13, 29], 'MOERTEL,': [14, 30], 'F.A.C.P.,': [16, 32], 'DONALD': [17, 33], 'S.': [18, 34], 'CHILDS,': [19, 35], 'JAMES': [21, 37], 'W.': [22, 38], 'ALBERS,': [23, 39], 'Ph.D.STEPHEN': [25], 'Ph.D.Author,': [41], 'Article,': [42, 272], 'and': [43, 59, 77, 105, 125, 130, 138, 156, 182, 243, 273, 294, 315, 371, 400, 413, 522, 533, 544, 553, 650, 656, 684, 689, 715, 719, 723, 741, 778, 780], 'Disclosure': [44, 274], 'Informationhttps://doi.org/10.7326/0003-4819-88-3-361': [45], 'SectionsAboutPDF': [46], 'ToolsAdd': [47], 'to': [48, 109, 135, 217, 346, 602, 622, 635, 757], 'favoritesDownload': [49], 'CitationsTrack': [50], 'CitationsPermissions': [51], 'ShareFacebookTwitterLinkedInRedditEmail': [52], 'ExcerptSpecial': [53], 'interest': [54], 'in': [55, 63, 83, 95, 123, 159, 180, 183, 202, 220, 247, 299, 319, 365, 377, 385, 437, 466, 472, 493, 499, 530, 548, 558, 594, 606, 658, 678, 703, 735, 753, 760, 801], 'hypoxic-cell': [56], 'radiation': [57, 106, 113, 714], 'sensitizers': [58], 'their': [60, 81], 'potential': [61], 'application': [62], 'the': [64, 73, 118, 221, 268, 292, 343, 347, 356, 366, 374, 386, 414, 485, 490, 579, 632, 643, 726, 744, 796], 'treatment': [65, 295, 428, 664, 789], 'of': [66, 75, 103, 117, 148, 175, 186, 197, 200, 226, 228, 245, 282, 284, 296, 328, 352, 362, 373, 381, 389, 418, 429, 449, 455, 460, 518, 525, 539, 566, 571, 578, 624, 631, 638, 642, 646, 667, 673, 687, 693, 706, 713, 728, 731, 746, 749, 775, 790, 795, 799, 834], 'malignant': [67], 'tumors': [68], 'has': [69], 'been': [70], 'stimulated': [71], 'by': [72, 128, 204, 528, 562, 587, 804], 'report': [74, 521], 'Urtasun': [76, 129], 'associates': [78], '(1)': [79], 'on': [80, 267, 434, 489, 709], 'experience': [82], 'patients': [84, 98, 110], 'highly': [86], 'anaplastic': [87], 'astrocytomas.': [88], 'The': [89], 'authors': [90], 'found': [91], 'a': [92, 101, 144, 178, 287, 320, 325, 401, 408, 438, 467, 500, 559, 659, 761], 'significant': [93], 'improvement': [94], 'survival': [96], 'for': [97, 291, 311, 333, 427, 590, 648, 654, 725, 743, 788], 'treated': [99, 111], 'combination': [102], 'metronidazole': [104, 120, 150, 158, 201, 425, 529, 634, 688, 787], 'therapy': [107, 114, 121], 'compared': [108], 'alone.': [115], 'high-dose': [119, 149, 157, 176, 227], 'used': [122], 'this': [124], 'earlier': [126], 'studies': [127], 'colleagues': [131], '(2)': [132], 'was': [133], 'limited': [134], 'anorexia,': [136], 'nausea,': [137], 'vomiting.': [139], 'These': [140], 'findings': [141], 'could': [142], 'encourage': [143], 'more': [145], 'widespread': [146], 'use': [147, 517], 'as': [151, 737], 'a...References1.': [152], 'URTASUNBANDCHAPMANFELDSTEINMIELKEFRYER': [153], 'RPJMBC:': [154], 'Radiation': [155, 729, 747], 'supratentorial': [160], 'glioblastomas.': [161], 'N': [162], 'Engl': [163], 'J': [164, 207], 'Med': [165], '294:1364-1367,': [166], '1976': [167], 'CrossrefMedlineGoogle': [168, 192, 211], 'Scholar2.': [169], 'URTASUNCHAPMANBANDRABINSTURMWIND': [170], 'RJPHJ:': [171], 'Phase': [172], 'I': [173], 'study': [174], 'metronidazole:': [177, 519], 'specific': [179], 'vivo': [181], 'vitro': [184, 704], 'radiosensitizer': [185], 'hypoxic': [187], 'cells.': [188], 'Radiology': [189], '117:129-133,': [190], '1975': [191], 'Scholar3.': [193], 'MIDHAMCGILVERAYCOOPER': [194], 'KIJ:': [195], 'Determination': [196], 'therapeutic': [198], 'levels': [199], 'plasma': [203], 'gas-liquid': [205], 'chromatography.': [206], 'Chromotogr': [208], '87:491-497,': [209], '1973': [210], 'Scholar4.': [212], 'SCHÄRER': [213], 'K:': [214], '[Selective': [215], 'injury': [216], 'Purkinje': [218], 'cells': [219], 'dog': [222], 'after': [223, 423, 663], 'oral': [224], 'administration': [225], 'nitroimidazole': [229], 'derivatives.]': [230], '(Ger.)': [231], 'Verh': [232], 'Dtsch': [233], 'Ges': [234], 'Pathol': [235], '56:407-410,': [236], '1972': [237], 'MedlineGoogle': [238, 255], 'Scholar5.': [239], 'PLACIDIMASUOKAALCARAZTAYLOREARLE': [240], 'GDAJR:': [241], 'Distribution': [242, 543], 'metabolism': [244], '14C-metronidazole': [246], 'mice.': [248], 'Arch': [249], 'Int': [250], 'Pharmacodyn': [251], 'Ther': [252], '188:168-179,': [253], '1970': [254], 'Scholar': [256], 'This': [257], 'content': [258], 'is': [259], 'PDF': [260, 269, 854], 'only.': [261], 'To': [262], 'continue': [263], 'reading': [264], 'please': [265], 'click': [266], 'icon.': [270], 'Author,': [271], 'InformationAffiliations:': [275], 'PreviousarticleNextarticle': [276], 'Advertisement': [277], 'FiguresReferencesRelatedDetails': [278], 'Metrics': [279], 'Cited': [280], 'byPharmacology': [281], 'AgingPharmacology': [283], 'AgingMetronidazole-induced': [285], 'encephalopathy:': [286], 'systematic': [288], 'reviewMetabolic': [289], 'interventions': [290], 'prevention': [293], 'daptomycin': [297], 'non-susceptibility': [298], 'Staphylococcus': [300], 'aureusSelf-assembled': [301], 'angiopep-2': [302], 'modified': [303], 'lipid-poly': [304], '(hypoxic': [305], 'radiosensitized': [306], 'polyprodrug)': [307], 'nanoparticles': [308], 'delivery': [309], 'TMZ': [310, 314], 'glioma': [312], 'synergistic': [313], 'RT': [316], 'therapyMetronidazole-induced': [317], 'encephalopathy': [318, 422, 657], 'patient': [321, 439, 660], 'pyogenic': [323], 'spondylitis:': [324], 'case': [326, 520], 'reportDesign': [327], 'Tumor': [329], 'Microenvironment-Responsive': [330], 'Drug–Drug': [331], 'Micelle': [332], 'Cancer': [334], 'RadiochemotherapyMetronidazole-Induced': [335], 'Encephalopathy': [336, 498], 'Thiamine': [338], 'DeficiencyToxic-induced': [339], 'cerebellar': [340, 446], 'syndrome:': [341], 'from': [342], 'fetal': [344], 'period': [345], 'elderlyDentate': [348], 'Update:': [349], 'Imaging': [350, 538, 546], 'Features': [351], 'Entities': [353], 'That': [354, 610], 'Affect': [355], 'Dentate': [357, 581], 'NucleusMagnetic': [358], 'resonance': [359], 'imaging': [360], 'patterns': [361], 'treatment-related': [363], 'toxicity': [364], 'pediatric': [367], 'brain:': [368], 'an': [369, 636], 'update': [370], 'review': [372], 'literatureDrug-Induced': [375], 'Seizures': [376, 492], 'Critically': [378, 494], 'Ill': [379, 495], 'PatientsManagement': [380], 'Inflammatory': [382], 'Bowel': [383, 411], 'Disease': [384, 412, 593], 'ElderlyNeurologic': [387], 'Complications': [388, 454, 570, 833], 'Hematopoietic': [390, 572, 835], 'Cell': [391, 574, 837], 'Transplantation56-Year-Old': [392], 'Male': [393], 'With': [394], 'Acute-Onset': [395], 'Ataxia': [396], 'After': [397], 'Use': [399, 727, 745], 'Typical': [402], 'MRI': [403, 584], 'AppearanceMetronidazole-Induced': [404], 'Encephalopathy:': [405, 541], 'Not': [406], 'Always': [407], 'Reversible': [409], 'SituationInflammatory': [410], 'Elderly:': [415], 'A': [416, 767], 'ReviewTreatment': [417], 'Clostridium': [419, 591], 'difficile': [420, 431], 'InfectionsMetronidazole-induced': [421], 'prolonged': [424, 516], 'course': [426], 'C.': [430], 'colitisReversible': [432], 'changes': [433], 'MR': [435], 'images': [436], 'metronidazole-induced': [441, 444], 'encephalopathyAntibiotic-Induced': [442], 'NeurotoxicityReversible': [443], 'subacute': [445], 'syndromeNeurologic': [447], 'manifestations': [448], 'inflammatory': [450], 'bowel': [451], 'diseasesIatrogenic': [452], 'neurologyNeurologic': [453], 'MetronidazoleToolbox:': [456], 'Neuropsychiatric': [457], 'adverse': [458], 'effects': [459, 478], 'antimicrobial': [461], 'agentsDisseminated': [462], 'Scedosporium': [463], 'prolificans': [464], 'infection': [465], 'German': [468], 'Shepherd': [469], 'dogMedication': [470], 'neurotoxicity': [471], 'childrenMetronidazole-Induced': [473], 'Central': [474], 'Nervous': [475, 808], 'System': [476, 809], 'ToxicityNeurotoxic': [477], 'associated': [479], 'antibiotic': [481, 633], 'use:': [482], 'management': [483], 'considerationsMetronidazoleCatching': [484], 'Seizure': [486], 'Culprit:': [487], 'Drugs': [488], 'DifferentialDrug-Induced': [491], 'PatientsMetronidazole': [496], 'Induced': [497, 586], 'Patient': [501, 762], 'Brain': [503], 'AbscessLésions': [504], 'cérébelleuses': [505], 'réversibles': [506], 'et': [507], 'neuropathie': [508], 'périphérique': [509], 'induites': [510], 'par': [511], 'le': [512], 'métronidazoleCerebellar': [513], 'ataxia': [514], 'following': [515], 'literature': [523], 'reviewEvaluation': [524], 'immunosuppression': [526], 'induced': [527], 'Balb/c': [531], 'mice': [532], 'human': [534, 802], 'peripheral': [535], 'blood': [536], 'lymphocytesMR': [537], 'Metronidazole-Induced': [540, 576, 583, 613, 627], 'Lesion': [542], 'Diffusion-Weighted': [545], 'FindingsNeurotoxicosis': [547], '4': [549], 'Cats': [550], 'Receiving': [551], 'RonidazoleTrichomoniasis': [552], 'its': [554], 'treatmentPutative': [555], 'Neurotoxicosis': [557], 'CatNeuropathy': [560], 'Caused': [561], 'DrugsMetronidazole-induced': [563], 'encephalopathyNeurologic': [564], 'complications': [565], 'bone': [567], 'marrow': [568], 'transplantationNeurologic': [569], 'Stem': [573, 836], 'TransplantationReversible': [575], 'Lesions': [577], 'Cerebellar': [580], 'NucleiToxic': [582], 'ChangesConvulsions': [585], 'Treatment': [589], 'difficile-Associated': [592], 'Chronic': [595], 'Renal': [596], 'FailureIATROGENIC': [597], 'SEIZURESANTIBIOTIC-INDUCED': [598], 'CONVULSIONSNeurologic': [599], 'Symptoms': [600], 'Due': [601], 'Possible': [603], 'Chromium': [604], 'Deficiency': [605], 'Long-Term': [607], 'Parenteral': [608], 'Nutrition': [609], 'Closely': [611], 'Mimic': [612], 'SyndromesZentralnervöse': [614], 'Nebenwirkungen': [615], 'verschiedener': [616], 'antibakterieller': [617], 'SubstanzenPotential': [618], 'Neurologic': [619], 'Related': [621], 'CiprofloxacinTherapy': [623], 'Urogenital': [625], 'TrichomoniasisPersistent': [626], 'Peripheral': [628], 'NeuropathyEnzymatic': [629], 'conversion': [630], 'analog': [637], 'thiamineThe': [639], 'bioorganic': [640], 'chemistry': [641], 'nitroalkyl': [644], 'groupUse': [645], 'microwaves': [647], 'acid': [649], 'alcohol': [651], 'fast': [652], 'staining.Measurements': [653], 'haemoglobinConvulsions': [655], 'leukemia': [662], 'metronidazole.Neurotoxicity': [666], 'MetronidazoleTHEODORE': [668], 'A.': [669], 'ALSTON,': [670], 'Ph.D.Induction': [672], 'Mammary': [674], 'Tumors': [675], 'Female': [679], 'Sprague-Dawley': [680], 'RatsCurrent': [681], 'clinical': [682], 'applications': [683], 'dose': [685], 'regimens': [686], 'related': [690], 'nitroimidazoles*The': [691], 'Neurotoxicity': [692], 'Antibacterial': [694], 'AgentsSHARON': [695], 'R.': [696, 700], 'SNAVELY,': [697], 'GLENN': [699], 'HODGES,': [701], 'M.D.The': [702], 'effect': [705], 'some': [707], 'nitroimidazoles': [708], 'microtubule': [710], 'formationChemical': [711], 'modifiers': [712], 'chemotherapy:': [716], 'tumor': [717], 'sensitization': [718], 'normal': [720], 'tissue': [721], 'protectionPotentials': [722], 'Limitations': [724, 742], 'Sensitizers': [730, 748], 'Resistant': [732, 750], 'Hypoxic': [733, 751], 'Cells': [734, 752], 'TumorsNitroimidazoles': [736], 'chemotherapeutic': [738], 'agentsZur': [739], 'Metronidazol-PolyneuropathiePotentials': [740], 'TumorsSevere': [754], 'toxic': [755], 'reaction': [756], 'tinidazoleMental': [758], 'Confusion': [759], 'Treated': [763], '-': [766], 'Concentration-Related': [768], 'Effect?Convulsions': [769], 'High': [772], 'Cumulative': [773], 'Doses': [774], 'MetronidazoleNeurotoxic': [776], 'radiosensitizers': [777], 'head': [779], 'neck': [781], 'cancer': [782], 'patients—How': [783], 'many': [784], 'will': [785], 'benefit?Intravenous': [786], 'infections': [791], 'involving': [792], 'anaerobic': [793], 'bacteriaDetection': [794], 'amine': [797], 'derivative': [798], 'misonidazole': [800], 'urine': [803], 'high-pressure': [805], 'liquid': [806], 'chromatographyCentral': [807], 'TherapyRODNEY': [814], 'K.': [815], 'KUSUMI,': [816], 'JOSEPH': [818], 'F.': [819], 'PLOUFFE,': [820], 'ROBERT': [822, 826], 'H.': [823], 'WYATT,': [824], 'J.': [827], 'FASS,': [828], 'M.D.Update:': [829], 'Adolescent': [830], 'GynecologyAntiprotozoal': [831], 'drugsNeurological': [832], 'Transplantation': [838], '1': [839, 851], '1978Volume': [841], '88,': [842], 'Issue': [843, 849], '3Page:': [844], '361-362KeywordsAstrocytomaCancer': [845], 'treatmentMalignant': [846], 'tumorsNauseaRadiation': [847], 'therapyToxicityVomiting': [848], 'Published:': [850], '1978': [853], 'downloadLoading': [855], '...': [856]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2082015870', 'counts_by_year': [{'year': 2023, 'cited_by_count': 2}, {'year': 2022, 'cited_by_count': 2}, {'year': 2021, 'cited_by_count': 1}, {'year': 2020, 'cited_by_count': 1}, {'year': 2019, 'cited_by_count': 2}, {'year': 2018, 'cited_by_count': 10}, {'year': 2017, 'cited_by_count': 2}, {'year': 2016, 'cited_by_count': 6}, {'year': 2015, 'cited_by_count': 10}, {'year': 2014, 'cited_by_count': 4}, {'year': 2013, 'cited_by_count': 5}, {'year': 2012, 'cited_by_count': 3}], 'updated_date': '2024-12-12T12:12:24.736866', 'created_date': '2016-06-24'}