Publication Information

{'id': 'https://openalex.org/W2069544210', 'doi': 'https://doi.org/10.1074/jbc.m410994200', 'title': 'Interleukin-8 Induces Nuclear Transcription Factor-κB through a TRAF6-dependent Pathway', 'display_name': 'Interleukin-8 Induces Nuclear Transcription Factor-κB through a TRAF6-dependent Pathway', 'publication_year': 2005, 'publication_date': '2005-02-01', 'ids': {'openalex': 'https://openalex.org/W2069544210', 'doi': 'https://doi.org/10.1074/jbc.m410994200', 'mag': '2069544210', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/15591054', 'pmcid': 'https://www.ncbi.nlm.nih.gov/pmc/articles/2740382'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m410994200', 'pdf_url': 'http://www.jbc.org/article/S0021925819628188/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925819628188/pdf', 'any_repository_has_fulltext': True}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5031631094', 'display_name': 'Sunil K. Manna', 'orcid': 'https://orcid.org/0000-0002-0149-209X'}, 'institutions': [{'id': 'https://openalex.org/I78270026', 'display_name': 'Centre for DNA Fingerprinting and Diagnostics', 'ror': 'https://ror.org/04psbxy09', 'country_code': 'IN', 'type': 'facility', 'lineage': ['https://openalex.org/I2799351866', 'https://openalex.org/I4210134808', 'https://openalex.org/I78270026']}], 'countries': ['IN'], 'is_corresponding': False, 'raw_author_name': 'Sunil K. Manna', 'raw_affiliation_strings': ['Laboratory of Immunology, Centre for DNA Fingerprinting and Diagnostics, Nacharam, Hyderabad 500 076, India'], 'affiliations': [{'raw_affiliation_string': 'Laboratory of Immunology, Centre for DNA Fingerprinting and Diagnostics, Nacharam, Hyderabad 500 076, India', 'institution_ids': ['https://openalex.org/I78270026']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5003764354', 'display_name': 'Govindarajan T. Ramesh', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I48205209', 'display_name': 'Texas Southern University', 'ror': 'https://ror.org/05ch0aw77', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I48205209']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Govindarajan T. Ramesh', 'raw_affiliation_strings': ['Department of Biology, Texas Southern University, Houston, Texas 77004'], 'affiliations': [{'raw_affiliation_string': 'Department of Biology, Texas Southern University, Houston, Texas 77004', 'institution_ids': ['https://openalex.org/I48205209']}]}], 'institution_assertions': [], 'countries_distinct_count': 2, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 3.206, 'has_fulltext': True, 'fulltext_origin': 'pdf', 'cited_by_count': 140, 'citation_normalized_percentile': {'value': 0.9998, 'is_in_top_1_percent': True, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 97, 'max': 98}, 'biblio': {'volume': '280', 'issue': '8', 'first_page': '7010', 'last_page': '7021'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T11591', 'display_name': 'NF-κB Signaling Pathways', 'score': 0.9999, 'subfield': {'id': 'https://openalex.org/subfields/1306', 'display_name': 'Cancer Research'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T11591', 'display_name': 'NF-κB Signaling Pathways', 'score': 0.9999, 'subfield': {'id': 'https://openalex.org/subfields/1306', 'display_name': 'Cancer Research'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11503', 'display_name': 'Cytokine Signaling Pathways and Interactions', 'score': 0.9992, 'subfield': {'id': 'https://openalex.org/subfields/2730', 'display_name': 'Oncology'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, {'id': 'https://openalex.org/T11668', 'display_name': 'interferon and immune responses', 'score': 0.9975, 'subfield': {'id': 'https://openalex.org/subfields/2403', 'display_name': 'Immunology'}, 'field': {'id': 'https://openalex.org/fields/24', 'display_name': 'Immunology and Microbiology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [], 'concepts': [{'id': 'https://openalex.org/C86339819', 'wikidata': 'https://www.wikidata.org/wiki/Q407384', 'display_name': 'Transcription factor', 'level': 3, 'score': 0.57333577}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.471502}, {'id': 'https://openalex.org/C95444343', 'wikidata': 'https://www.wikidata.org/wiki/Q7141', 'display_name': 'Cell biology', 'level': 1, 'score': 0.37935078}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.25792313}, {'id': 'https://openalex.org/C104317684', 'wikidata': 'https://www.wikidata.org/wiki/Q7187', 'display_name': 'Gene', 'level': 2, 'score': 0.10550377}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.08169821}], 'mesh': [{'descriptor_ui': 'D016209', 'descriptor_name': 'Interleukin-8', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': True}, {'descriptor_ui': 'D016328', 'descriptor_name': 'NF-kappa B', 'qualifier_ui': 'Q000235', 'qualifier_name': 'genetics', 'is_major_topic': True}, {'descriptor_ui': 'D048029', 'descriptor_name': 'TNF Receptor-Associated Factor 6', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D001773', 'descriptor_name': 'Blood Cells', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002458', 'descriptor_name': 'Cell Fractionation', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D045744', 'descriptor_name': 'Cell Line, Tumor', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004305', 'descriptor_name': 'Dose-Response Relationship, Drug', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D005786', 'descriptor_name': 'Gene Expression Regulation', 'qualifier_ui': 'Q000187', 'qualifier_name': 'drug effects', 'is_major_topic': False}, {'descriptor_ui': 'D006801', 'descriptor_name': 'Humans', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D051550', 'descriptor_name': 'I-kappa B Kinase', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D053592', 'descriptor_name': 'Interleukin-1 Receptor-Associated Kinases', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011494', 'descriptor_name': 'Protein Kinases', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D017346', 'descriptor_name': 'Protein Serine-Threonine Kinases', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D015398', 'descriptor_name': 'Signal Transduction', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D020742', 'descriptor_name': 'rhoA GTP-Binding Protein', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}], 'locations_count': 4, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m410994200', 'pdf_url': 'http://www.jbc.org/article/S0021925819628188/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': True, 'landing_page_url': 'https://europepmc.org/articles/pmc2740382', 'pdf_url': 'https://europepmc.org/articles/pmc2740382?pdf=render', 'source': {'id': 'https://openalex.org/S4306400806', 'display_name': 'Europe PMC (PubMed Central)', 'issn_l': None, 'issn': None, 'is_oa': True, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1303153112', 'host_organization_name': 'European Bioinformatics Institute', 'host_organization_lineage': ['https://openalex.org/I1303153112'], 'host_organization_lineage_names': ['European Bioinformatics Institute'], 'type': 'repository'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'acceptedVersion', 'is_accepted': True, 'is_published': False}, {'is_oa': True, 'landing_page_url': 'https://www.ncbi.nlm.nih.gov/pmc/articles/PMC2740382', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S2764455111', 'display_name': 'PubMed Central', 'issn_l': None, 'issn': None, 'is_oa': True, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': 'acceptedVersion', 'is_accepted': True, 'is_published': False}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/15591054', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m410994200', 'pdf_url': 'http://www.jbc.org/article/S0021925819628188/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [{'display_name': 'Good health and well-being', 'score': 0.45, 'id': 'https://metadata.un.org/sdg/3'}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 60, 'referenced_works': ['https://openalex.org/W1489250066', 'https://openalex.org/W1505821987', 'https://openalex.org/W1548377812', 'https://openalex.org/W1567210565', 'https://openalex.org/W1716401081', 'https://openalex.org/W1925157258', 'https://openalex.org/W1970579022', 'https://openalex.org/W1971353320', 'https://openalex.org/W1974668637', 'https://openalex.org/W1976648310', 'https://openalex.org/W1977348907', 'https://openalex.org/W1981486175', 'https://openalex.org/W1986835831', 'https://openalex.org/W1990163154', 'https://openalex.org/W1992517860', 'https://openalex.org/W1993814619', 'https://openalex.org/W1994888948', 'https://openalex.org/W1996293435', 'https://openalex.org/W1996635688', 'https://openalex.org/W1999881028', 'https://openalex.org/W2000000541', 'https://openalex.org/W2006219739', 'https://openalex.org/W2010052831', 'https://openalex.org/W2016134079', 'https://openalex.org/W2018114151', 'https://openalex.org/W2029790299', 'https://openalex.org/W2032514624', 'https://openalex.org/W2032972084', 'https://openalex.org/W2037283275', 'https://openalex.org/W2050226161', 'https://openalex.org/W2052428304', 'https://openalex.org/W2053102794', 'https://openalex.org/W2058855680', 'https://openalex.org/W2059009159', 'https://openalex.org/W2059289753', 'https://openalex.org/W2059730733', 'https://openalex.org/W2061726942', 'https://openalex.org/W2067489401', 'https://openalex.org/W2075219502', 'https://openalex.org/W2084684444', 'https://openalex.org/W2090703365', 'https://openalex.org/W2103066940', 'https://openalex.org/W2105889936', 'https://openalex.org/W2110105332', 'https://openalex.org/W2116063836', 'https://openalex.org/W2142887196', 'https://openalex.org/W2145921423', 'https://openalex.org/W2150467353', 'https://openalex.org/W2167994763', 'https://openalex.org/W2183069405', 'https://openalex.org/W2188779778', 'https://openalex.org/W2197083763', 'https://openalex.org/W2263076965', 'https://openalex.org/W2288913919', 'https://openalex.org/W2440788947', 'https://openalex.org/W305754995', 'https://openalex.org/W4295677776', 'https://openalex.org/W54801374', 'https://openalex.org/W62571714', 'https://openalex.org/W67368441'], 'related_works': ['https://openalex.org/W4391375266', 'https://openalex.org/W4387497383', 'https://openalex.org/W2948807893', 'https://openalex.org/W2778153218', 'https://openalex.org/W2748952813', 'https://openalex.org/W2527526854', 'https://openalex.org/W2078814861', 'https://openalex.org/W1986764834', 'https://openalex.org/W1976181487', 'https://openalex.org/W1531601525'], 'abstract_inverted_index': {'Considering': [0, 228], 'the': [1, 15, 114, 193, 198, 221, 229, 243, 342, 421, 426, 449, 464, 705, 896, 1163, 1270, 1274, 1313, 1352, 1436, 1445, 1607, 1619, 1624, 1632, 1894, 2016, 2024, 2122, 2129, 2179, 2196, 2209, 2230, 2246, 2256, 2284, 2428, 2497, 2619, 2749, 2870, 2893, 2896, 2937, 3027, 3037, 3135, 3146, 3175, 3190, 3252, 3316, 3403, 3412, 3454, 3514, 3675, 3680, 3719, 3731, 3756, 3765, 3771, 3782, 3809, 3828, 3914, 4063, 4095, 4102, 4119, 4124, 4146, 4161, 4216, 4250, 4261, 4269, 4323, 4339, 4354, 4357], 'potential': [2, 230], 'role': [3, 231, 472, 482, 1182, 3810], 'of': [4, 33, 156, 160, 211, 220, 223, 232, 261, 384, 388, 439, 448, 451, 527, 763, 795, 823, 865, 1002, 1175, 1185, 1276, 1278, 1288, 1301, 1315, 1320, 1354, 1438, 1444, 1448, 1617, 1634, 1685, 1963, 1969, 2034, 2062, 2094, 2114, 2119, 2168, 2183, 2195, 2211, 2229, 2232, 2238, 2287, 2496, 2499, 2560, 2599, 2707, 2765, 2777, 2842, 2864, 2885, 2895, 2948, 2984, 3098, 3104, 3117, 3134, 3170, 3180, 3185, 3304, 3340, 3405, 3411, 3432, 3434, 3456, 3460, 3472, 3526, 3533, 3679, 3707, 3716, 3735, 3758, 3767, 3773, 3811, 3872, 3883, 3936, 3954, 3960, 3970, 4021, 4066, 4091, 4113, 4116, 4130, 4164, 4178, 4219, 4239, 4247, 4280, 4299], 'interleukin-8': [5, 233], '(IL-8)': [6, 234], 'in': [7, 19, 44, 52, 56, 103, 168, 205, 235, 247, 272, 280, 284, 331, 396, 433, 463, 473, 483, 605, 773, 886, 905, 952, 1009, 1183, 1188, 1376, 1519, 1614, 1828, 2086, 2116, 2213, 2263, 2281, 2425, 2435, 2513, 2562, 2646, 2653, 3425, 3491, 3495, 3508, 3573, 3584, 3649, 3702, 3764, 3803, 3861, 3895, 3904, 3919, 3928, 3989, 4183, 4225, 4272, 4327, 4336], 'inflammation,': [8, 236], 'angiogenesis,': [9, 237, 2216], 'tumorigenesis,': [10, 238], 'and': [11, 35, 78, 89, 98, 106, 158, 190, 209, 213, 226, 239, 263, 306, 317, 326, 334, 386, 418, 437, 441, 454, 460, 466, 475, 486, 770, 863, 908, 957, 962, 1004, 1012, 1052, 1190, 1268, 1290, 1306, 1317, 1373, 1384, 1521, 1538, 1623, 1690, 1812, 1818, 1838, 1882, 1891, 2018, 2021, 2026, 2071, 2078, 2084, 2089, 2102, 2110, 2170, 2181, 2201, 2215, 2217, 2269, 2305, 2321, 2366, 2368, 2387, 2401, 2427, 2437, 2445, 2476, 2486, 2531, 2554, 2556, 2611, 2638, 2640, 2667, 2748, 2775, 2876, 2911, 2926, 2959, 3026, 3050, 3101, 3112, 3158, 3229, 3254, 3315, 3354, 3430, 3477, 3550, 3564, 3615, 3628, 3636, 3677, 3704, 3737, 3857, 3859, 3865, 3932, 4111, 4127, 4158, 4186, 4236, 4244, 4290, 4293, 4322], 'metastasis,': [12, 240], 'we': [13, 25, 241, 253, 2052, 2124, 2160, 2224, 2243, 3401, 4266, 4304], 'investigated': [14, 242, 4305], 'molecular': [16, 244, 3724], 'mechanism': [17, 245, 3404], 'involved': [18, 246, 604, 1187, 1375, 1518], 'IL-8-mediated': [20, 248, 1166, 2092, 2117, 2233, 2249, 3406, 3521, 3597, 3604, 3665, 4147], 'signaling.': [21, 249, 3605], 'In': [22, 250, 697, 2049, 2240, 3398], 'this': [23, 251, 2050, 2241, 2514, 3399, 3441, 3548], 'report': [24, 200, 252, 428, 2004, 2242], 'provide': [26, 254], 'evidence': [27, 255], 'that': [28, 142, 172, 201, 256, 370, 400, 429, 951, 1612, 2006, 2055, 2162, 2220, 2227, 3503, 3576, 3596, 3653, 3664, 3730, 3798, 3923, 4040, 4268, 4364], 'like': [29, 257, 1368, 1387, 2199], 'TNF,': [30, 258, 1536, 3965, 3982, 4013, 4027], 'an': [31, 259, 2277, 4153, 4300], 'inducer': [32, 260, 1287], 'NF-κB': [34, 43, 50, 110, 144, 163, 182, 204, 212, 262, 271, 278, 338, 372, 391, 410, 432, 440, 1178, 1261, 1289, 1298, 1321, 1347, 1358, 1451, 1897, 1964, 2030, 2095, 2250, 2677, 2681, 2718, 2739, 2865, 2977, 3451, 3483, 3487, 3506, 3516, 3567, 3591, 3598, 3609, 3658, 3666, 3717, 3769, 3776, 3801, 4044, 4117, 4148], 'also': [36, 82, 264, 310, 708, 965, 1291, 1385, 1531, 2065, 2081], 'a': [37, 45, 53, 63, 104, 148, 169, 206, 265, 273, 281, 291, 332, 376, 397, 434, 480, 600, 702, 902, 1173, 1180, 1285, 1515, 1971, 2002, 2059, 2087, 3043, 3156, 3257, 3265, 3492, 3722, 3854, 3896, 3929], 'NF-κB-dependent': [38, 69, 266, 297, 2067, 2072, 2785, 2791, 3792, 3814, 3972, 4067, 4076, 4199], 'gene': [39, 71, 267, 299, 2069, 2793, 3054, 3816, 3830, 3973], 'product,': [40, 268], 'IL-8': [41, 48, 67, 81, 92, 202, 269, 276, 295, 309, 320, 430, 700, 764, 888, 1046, 1388, 1439, 1513, 1529, 2056, 2064, 2080, 2127, 2163, 2188, 2212, 2221, 2276, 2289, 2334, 2915, 3119, 3181, 3305, 3310, 3341, 3348, 3449, 3457, 3473, 3504, 3527, 3549, 3577, 3587, 3619, 3635, 3656, 3661, 3790, 3799, 3812, 3884, 3924, 3944, 3961, 3967, 4025, 4059, 4108, 4179, 4207, 4240, 4248, 4283, 4286, 4307, 4316, 4347, 4365], 'induces': [42, 49, 68, 83, 93, 203, 270, 277, 296, 311, 321, 431, 2066, 2082, 2202, 3505, 3800, 4208, 4287], 'unique': [46, 274], 'pathway.': [47, 275], 'activation': [51, 111, 145, 159, 164, 183, 210, 279, 339, 373, 387, 392, 411, 438, 1962, 2031, 2118, 2237, 2963, 3164, 3459, 3488, 3599, 3610, 3667, 3802, 4045, 4065, 4149, 4298], 'dose-dependent': [54, 282, 3493, 3930], 'manner': [55, 283, 3494], 'different': [57, 285, 3115, 3302, 3307, 3338, 3344, 3435, 3470, 3804, 3881, 4061, 4320], 'cell': [58, 286, 458, 575, 892, 955, 960, 2145, 2510, 3126, 3317, 3447, 3522, 3805, 4085], 'types': [59, 287], 'as': [60, 73, 75, 288, 301, 303, 1379, 2058, 2075, 2517, 2687, 2782, 2797, 2935, 2961, 3059, 3162, 3193, 3268, 3329, 3747, 3910, 4331], 'detected': [61, 289], 'by': [62, 87, 154, 290, 315, 382, 799, 999, 1264, 1294, 1299, 1304, 1450, 1682, 1967, 2099, 2107, 2173, 2447, 2458, 2491, 2594, 2618, 2769, 2892, 2982, 3189, 3238, 3264, 3369, 3484, 3568, 3603, 3613, 3617, 3671, 3684, 3842, 4049, 4079, 4123, 4152, 4169, 4195], 'DNA-protein': [64, 292, 2750], 'binding': [65, 175, 293, 403, 2740, 2766], 'assay.': [66, 294], 'reporter': [70, 298, 2068, 2792, 2971, 3053, 3815], 'expression': [72, 300, 1275, 1353, 2070, 3055], 'well': [74, 302, 1170, 3423], 'ICAM-1,': [76, 304, 2076, 2362], 'VCAM-1,': [77, 305, 2077, 2363], 'Cox-2': [79, 307, 2367], 'expression.': [80, 308], 'IκBα': [84, 312, 530, 1316, 2184, 2487, 2856, 2985, 4131, 4156, 4165, 4172, 4200, 4209, 4220, 4231, 4251, 4288], 'phosphorylation': [85, 313, 2180, 4157, 4289], 'followed': [86, 153, 314, 381, 1303, 2172, 3237, 3841], 'degradation': [88, 316, 1314, 2182, 4129, 4173], 'p65': [90, 318, 3186, 3235, 3698, 3738], 'translocation.': [91, 319], 'c-Jun': [94, 322, 537, 1834], 'N-terminal': [95, 323, 538, 1835], 'kinase': [96, 101, 324, 329, 589, 1637, 1821, 1823, 1824, 1832, 1836, 2134, 3363], '(JNK)': [97, 325], 'mitogen-activated': [99, 327, 541, 1819], 'protein': [100, 328, 542, 1820, 2553, 3784], '(MAPK)': [102, 330, 1822], 'dose-': [105, 333], 'time-dependent': [107, 335, 4064], 'manner.': [108, 336, 2091], 'IL-8-induced': [109, 143, 162, 181, 224, 337, 371, 390, 409, 452, 2790, 3486, 3783], 'is': [112, 129, 165, 197, 340, 357, 393, 425, 603, 701, 707, 895, 901, 997, 1262, 1284, 1292, 1348, 1442, 1514, 1606, 1965, 2013, 2032, 2235, 3518, 3600, 3611, 3668, 4046, 4121], 'for': [113, 341, 793, 898, 968, 1045, 2126, 2267, 2465, 2472, 2479, 2742, 2848, 2908, 2918, 2931, 2953, 3122, 3440, 3474, 3536, 3553, 3566, 3625, 3645, 3838, 3844, 3889, 3997, 4000, 4060, 4105, 4319], 'most': [115, 343, 3410], 'part': [116, 344], 'unaltered': [117, 345], 'when': [118, 346], 'cells': [119, 177, 347, 405, 1014, 1055, 2536, 2550, 2558, 2609, 2643, 2672, 2828, 2904, 3021, 3039, 3087, 3109, 3225, 3415, 3420, 3463, 3497, 3543, 3631, 3691, 3819, 3850, 3873, 3950, 3977, 4053, 4185, 4312], 'are': [120, 348, 964, 1047, 1168, 2244, 3908], 'transfected': [121, 349, 2831, 3822, 4052], 'with': [122, 131, 188, 350, 359, 416, 2399, 2415, 2659, 2713, 2771, 2832, 2839, 2861, 2914, 2964, 3024, 3091, 3095, 3114, 3130, 3145, 3155, 3219, 3231, 3245, 3248, 3300, 3309, 3336, 3347, 3469, 3530, 3547, 3586, 3622, 3634, 3694, 3781, 3823, 3833, 3880, 3980, 3991, 4024, 4056, 4213, 4263, 4315, 4345], 'dominant-negative': [123, 132, 351, 360, 2477, 2845], 'TRADD,': [124, 352, 561, 2480, 2849], 'FADD,': [125, 353, 2481, 2850], 'or': [126, 136, 178, 354, 364, 406, 2138, 2290, 2855, 2916, 2990, 3120, 3306, 3342, 3437, 3583, 3701, 3709, 3749, 3834, 3885, 3945, 3962, 3983, 3988, 4014, 4026, 4042], 'TRAF2,': [127, 355, 2482, 2851], 'but': [128, 150, 356, 378, 2104, 4028], 'inhibited': [130, 358, 2106, 2981], 'TRAF6-,': [133, 361], 'NIK-,': [134, 362], 'IKK-,': [135, 363], 'IκBα-transfected': [137, 365], 'cells.': [138, 180, 366, 408, 2969, 3510], 'The': [139, 367, 1043, 2469, 2546, 2763, 2882, 2943, 3125, 3168, 3428, 3559, 3570, 3647, 3760, 3847, 3899, 3917, 3975, 4011, 4019, 4081, 4192, 4361], 'data': [140, 368, 2207, 2247], 'suggest': [141, 369, 950, 1435, 3502, 4363], 'proceeds': [146, 184, 374, 412], 'through': [147, 186, 192, 375, 414, 420, 801, 1631, 2166, 2193, 2236, 2255, 4297], 'TRAF2-independent': [149, 377], 'TRAF6-dependent': [151, 379], 'pathway,': [152, 208, 380, 436, 2198, 2258], 'recruitment': [155, 383, 794, 1300, 1633, 1684, 2167], 'IRAK': [157, 385, 2169, 2547, 2552, 2561, 2563], 'IKK.': [161, 389, 4310], 'not': [166, 394, 1169, 2097, 3589, 3616, 3669, 4029, 4032, 4047, 4254], 'observed': [167, 395, 3940, 4071], 'cell-permeable': [170, 398], 'peptide': [171, 399, 2140, 2414, 2431, 2879], 'has': [173, 401], 'TRAF6': [174, 189, 402, 417, 1605, 2171], 'motif-treated': [176, 404], 'IRAK-deficient': [179, 407], 'mostly': [185, 413], 'interaction': [187, 415], 'partially': [191, 419, 2192], 'Rho-GTPase': [194, 422], 'pathways.': [195, 423], 'This': [196, 424, 2970, 3593], 'first': [199, 427], 'distinct': [207, 435], 'its': [214, 442, 470, 2190, 2265, 3788, 4257], 'dependent': [215, 443], 'genes': [216, 444, 1186, 1356, 1367, 1374, 2073], 'may': [217, 445], 'be': [218, 446, 2261], 'one': [219, 447, 1443, 2228], 'pathways': [222, 450], 'inflammation': [225, 453, 1189, 1449, 1520, 2214, 2234], 'angiogenesis.': [227, 455], 'Chemokines': [456], 'regulate': [457, 1532], 'migration': [459], 'leukocyte': [461], 'homing': [462], 'inflammatory': [465, 474], 'allergic': [467, 476], 'sites.': [468], 'Beside': [469], 'crucial': [471, 903], 'responses,': [477], 'chemokines': [478, 1386], 'play': [479], 'vital': [481], 'tumor-associated': [484], 'angiogenesis': [485, 970, 996, 1167], 'tumor': [487, 906, 969, 1011, 1054], 'progression.': [488], 'Interleukin-8': [489], '(IL-8),': [490], '1The': [491], 'abbreviations': [492], 'used': [493, 2512, 3322], 'are:': [494], 'IL-8,': [495, 2354, 3614, 3981, 4012], 'interleukin-8;': [496], 'C3': [497, 501, 2453], 'toxin,': [498], 'C.': [499, 660, 1699, 1844, 2577], 'botulinum': [500], 'transferase;': [502], 'CE,': [503], 'cytoplasmic': [504, 4162], 'extract;': [505, 546], 'Cox,': [506], 'cyclooxygenase;': [507], 'DN,': [508], 'dominant-negative;': [509], 'EMSA,': [510, 3685], 'electrophoretic': [511], 'mobility': [512, 3757], 'shift': [513, 2372], 'assay;': [514], 'FMLP,': [515, 2295], 'formyl': [516], 'methionyl': [517, 1958], 'leucyl': [518, 1959], 'phenylalanine;': [519], 'ICAM,': [520], 'intracellular': [521, 866], 'adhesion': [522, 576, 1380], 'molecule;': [523, 577], 'IκBα,': [524, 1309, 2359], 'inhibitory': [525], 'subunit': [526, 3715], 'κB;': [528, 551], 'IKK,': [529, 2175, 2485, 2854, 4303], 'kinase;': [531, 535, 539, 543, 590, 597], 'IRAK,': [532, 1688, 2385], 'interleukin-1': [533], 'receptor-associated': [534, 563, 568, 1636, 2133], 'JNK,': [536, 2361], 'MAPK,': [540, 3356], 'NE,': [544], 'nuclear': [545, 548, 2708, 3183, 3478, 3560, 3686], 'NF-κB,': [547, 1533, 2223, 3461], 'transcription': [549, 1176, 1895, 2794], 'factor': [550, 1896, 2419], 'PBMC,': [552], 'peripheral': [553], 'blood': [554, 2607, 2617], 'mononuclear': [555, 2608], 'cells;': [556], 'SEAP,': [557], 'secretory': [558, 2872], 'alkaline': [559, 2873], 'phosphatase;': [560], 'TNF': [562, 567, 1620, 2342, 2917, 3121, 3886], 'death': [564, 963], 'domain;': [565], 'TRAF,': [566], 'factor;': [569], 'TRAF6-BP,': [570], 'TRAF6-binding': [571, 2139, 2413, 2430], 'peptide;': [572], 'VCAM,': [573], 'vascular': [574], 'GFP,': [578], 'green': [579, 2877], 'fluorescent': [580, 2878, 2950, 3044, 3855], 'protein;': [581], 'GST,': [582], 'glutathione': [583], 'S-transferase;': [584], 'Ab,': [585], 'antibody;': [586], 'MEK,': [587], 'MAP': [588, 3362], 'PI3K,': [591], 'phosphatidylinositol': [592], '3-kinase;': [593], 'ERK,': [594, 2364], 'extracellular': [595], 'signal-regulated': [596], 'DAPI,': [598], '4,6-diamidino-2-phenylindole.': [599], 'CXC': [601], 'chemokine,': [602], 'these': [606, 1279, 2115, 3419, 4294], 'processes': [607], '(1Koch': [608], 'A.E.': [609], 'Polverini': [610, 635, 977, 1080], 'P.J.': [611, 636, 978, 1081, 1114], 'Kunkel': [612, 646, 806, 1082], 'S.L.': [613, 647, 807, 1083, 1455], 'Harlow': [614], 'L.A.': [615, 617, 1842], 'DiPietro': [616], 'Elner': [618, 620], 'V.M.': [619], 'S.G.': [621, 735], 'Strieter': [622, 1092], 'R.M.': [623, 634, 1093], 'Science.': [624, 813, 939], '1992;': [625], '258:': [626], '1798-1801Crossref': [627], 'PubMed': [628, 654, 669, 694, 723, 756, 817, 858, 883, 943, 990, 1026, 1038, 1073, 1100, 1127, 1216, 1233, 1256, 1331, 1428, 1462, 1490, 1507, 1579, 1600, 1675, 1711, 1739, 1769, 1785, 1807, 1851, 1873, 1917, 1939, 1952, 1996, 2044, 2155, 2633, 2699, 2821, 3013, 3081, 3214, 3292, 3393, 4138], 'Scopus': [629, 655, 670, 724, 757, 818, 859, 944, 991, 1027, 1039, 1074, 1101, 1128, 1203, 1257, 1429, 1463, 1491, 1580, 1601, 1676, 1712, 1740, 1770, 1786, 1808, 1852, 1874, 1918, 1940, 1953, 1997, 2045, 2156, 2700, 2822, 3014, 3082, 3215, 3293, 3394, 4139], '(1910)': [630], 'Google': [631, 657, 672, 695, 726, 759, 790, 820, 837, 861, 884, 933, 946, 993, 1029, 1041, 1076, 1103, 1130, 1160, 1205, 1217, 1234, 1259, 1332, 1344, 1411, 1431, 1465, 1493, 1508, 1562, 1582, 1603, 1678, 1714, 1742, 1772, 1788, 1810, 1854, 1876, 1920, 1942, 1955, 1999, 2047, 2158, 2634, 2702, 2824, 3016, 3084, 3217, 3295, 3396, 4141], 'Scholar,': [632, 658, 673, 727, 934, 1030, 1077, 1104, 1131, 1206, 1218, 1235, 1333, 1412, 1466, 1494, 1563, 1583, 1715, 1743, 1773, 1789, 1855, 1921, 1943], '2Strieter': [633], 'Arenberg': [637], 'D.A.': [638], 'Walz': [639], 'A.': [640, 664, 843, 1061, 1394, 1472, 1545, 1747, 1753, 1984, 2692, 3063, 3196], 'Opdenakker': [641], 'G.': [642, 2460], 'Van': [643, 777], 'Damme': [644, 778], 'J.': [645, 648, 716, 717, 779, 785, 852, 874, 915, 929, 936, 974, 980, 1032, 1094, 1456, 1479, 1501, 1695, 1701, 1723, 1728, 1758, 1780, 1845, 1906, 1928, 1985, 2628, 2810, 3002, 3070, 3203, 3281, 3382], 'Leukocyte': [649, 1846], 'Biol.': [650, 719, 854, 875, 1224, 1458, 1480, 1503, 1729, 1759, 1847, 1907, 1929, 1986, 2586, 2811, 3003, 3071, 3204, 3282, 3383], '1995;': [651, 1035, 1931], '57:': [652], '752-762Crossref': [653], '(252)': [656], '3Murdoch': [659], 'Monk': [661], 'P.N.': [662], 'Finn': [663], 'Cytokine.': [665], '1999;': [666, 982, 1870, 2587, 4135], '11:': [667], '704-712Crossref': [668], '(235)': [671], '4Salcedo': [674], 'R.': [675, 845, 917, 1149, 1193, 1589], 'Ponce': [676], 'M.L.': [677, 731, 1108, 2037], 'Young': [678, 748], 'H.A.': [679], 'Wasserman': [680], 'K.': [681, 938, 1110, 1133, 1337, 1587, 1591, 1660, 2579], 'Ward': [682], 'J.M.': [683, 1112, 1801], 'Kleinman': [684], 'H.K.': [685], 'Oppenheim': [686, 1499], 'J.J.': [687, 1500], 'Murphy': [688, 732], 'W.J.': [689], 'Blood.': [690, 2151], '2000;': [691, 930, 1119, 1157, 1420, 1571], '96:': [692], '34-40Crossref': [693], 'Scholar).': [696, 760, 947, 994, 1042, 1161, 1260, 1345, 1432, 1509, 1604, 1679, 1877, 1956, 2000, 2048, 2635, 2703, 2825, 3017, 3085, 3296, 3397, 4142], 'biological': [698], 'solution': [699], 'dimer,': [703], 'although': [704], 'monomer': [706], 'biologically': [709], 'active': [710, 3971], '(5Schnitzel': [711], 'W.': [712, 1474], 'Monschein': [713], 'U.': [714], 'Besemer': [715], 'Leukoc.': [718, 853, 1457, 1502], '1994;': [720, 753, 1020, 1097], '55:': [721], '763-770Crossref': [722], '(45)': [725, 2701], '6Burrows': [728], 'S.D.': [729, 1453], 'Doyle': [730], 'K.P.': [733], 'Franklin': [734], 'White': [736], 'J.R.': [737, 745, 828, 1642], 'Brooks': [738], 'I.': [739, 830], 'McNulty': [740], 'D.E.': [741], 'Scott': [742], 'M.O.': [743], 'Knutson': [744], 'Porter': [746], 'D.': [747, 1195, 1496, 1652, 2502], 'P.R.': [749], 'Hensley': [750], 'P.': [751, 1141, 1392, 1543], 'Biochemistry.': [752], '33:': [754], '12741-12745Crossref': [755], '(146)': [758], 'Biological': [761], 'functions': [762], 'include': [765, 1365], 'plasma': [766], 'exudation,': [767], 'neutrophil': [768], 'accumulation,': [769], 'general': [771], 'granulocytophilia': [772], 'vivo': [774], '(7Rampart': [775], 'M.': [776, 871, 873, 925, 1147, 1400, 1470, 1551, 1646, 1656, 1658, 1867, 2501, 2575], 'Zonnekeyn': [780], 'L.': [781, 919, 1059], 'Herman': [782], 'A.G.': [783], 'Am.': [784, 979], 'Pathol.': [786, 981], '1989;': [787], '135:': [788, 1598], '21-25PubMed': [789], 'Scholar),': [791, 821, 838, 862], 'chemotaxis': [792], 'leukocytes': [796], 'mainly': [797], 'neutrophils': [798, 824, 2612], 'diapedesis': [800], 'endothelial': [802, 959], 'spaces': [803], '(8Huber': [804], 'A.R.': [805, 1468, 4133], 'Todd': [808], '3rd.,': [809], 'R.F.': [810], 'Weiss': [811], 'S.J.': [812, 1139, 1398, 1549], '1991;': [814], '254:': [815], '99-102Crossref': [816], '(658)': [819], 'degranulation': [822], '(9Smith': [825], 'W.B.': [826], 'Gamble': [827], 'Clark-Lewis': [829], 'Vadas': [831], 'M.A.': [832], 'Immunol.': [833, 1212, 1327, 1596, 1707, 1781, 2629], '1993;': [834], '78:': [835], '491-497PubMed': [836], 'respiratory': [839], 'burst': [840], 'response': [841], '(10Derevianko': [842], "D'Amico": [844], 'Graeber': [846], 'T.': [847, 1390, 1541, 1648, 2805, 2997, 3276, 3377], 'Keeping': [848], 'H.': [849, 1640, 1670, 1721, 1751], 'Simms': [850], 'H.H.': [851, 1241], '1997;': [855, 1065, 1213, 1225, 1328, 1909, 2630], '62:': [856], '268-276Crossref': [857], '(22)': [860], 'mobilization': [864], 'Ca2+': [867], '(11Dewald': [868], 'B.': [869, 1644, 1705, 1861, 2493, 2494], 'Thelen': [870], 'Baggiolini': [872], 'Chem.': [876, 1481, 1730, 1760, 1908, 1930, 1987, 2812, 3004, 3072, 3205, 3283, 3384], '1988;': [877], '263:': [878], '16179-161884Abstract': [879], 'Full': [880, 985, 987, 1023, 1068, 1070, 1122, 1124, 1200, 1228, 1230, 1423, 1425, 1485, 1487, 1574, 1576, 1734, 1736, 1764, 1766, 1912, 1914, 1934, 1936, 1991, 1993, 2816, 2818, 3008, 3010, 3076, 3078, 3209, 3211, 3287, 3289, 3388, 3390], 'Text': [881, 986, 988, 1024, 1069, 1071, 1123, 1125, 1201, 1229, 1231, 1424, 1426, 1486, 1488, 1575, 1577, 1735, 1737, 1765, 1767, 1913, 1915, 1935, 1937, 1992, 1994, 2817, 2819, 3009, 3011, 3077, 3079, 3210, 3212, 3288, 3290, 3389, 3391], 'PDF': [882, 989, 1025, 1072, 1126, 1202, 1232, 1427, 1489, 1578, 1738, 1768, 1916, 1938, 1995, 2820, 3012, 3080, 3213, 3291, 3392], 'Scholar)': [885, 1811, 2159, 2590, 3218], 'vitro.': [887], 'specifically': [889, 3601], 'chemoattracts': [890], 'several': [891, 1265, 1355], 'types,': [893], 'which': [894, 1310, 1441, 1827, 2142, 2259, 2566], 'basis': [897], 'inflammation.': [899], 'Neovascularization': [900], 'step': [904], 'growth': [907, 2418], 'metastasis': [909, 2268], '(12Fidler': [910], 'I.J.': [911, 1016], 'Singh': [912, 1661], 'R.K.': [913, 1106, 1797], 'Yoneda': [914], 'Kumar': [916, 1746], 'Xu': [918], 'Dong': [920], 'Z.': [921, 1717, 1775, 2581], 'Bielenberg': [922], 'D.R.': [923, 1079], 'McCarty': [924], 'Ellis': [926, 1017], 'L.M.': [927, 1018], 'Cancer': [928, 1155, 1406, 1557, 2504], '6:': [931, 1158], 'S225-S226PubMed': [932], '13Folkman': [935], 'Camphausen': [937], '2001;': [940, 1252, 1504], '293:': [941], '227-228Crossref': [942], '(85)': [945], 'Recent': [948], 'reports': [949, 1434], 'addition': [953, 2894], 'to': [954, 1312, 1526, 1535, 2015, 2178, 2570, 2869, 2966, 3323, 3481, 3520, 3660, 3713, 3721, 3779, 3827, 4118], 'proliferation': [956], 'migration,': [958], 'survival': [961], 'important': [966, 2278], 'components': [967], '(14Nor': [971], 'J.E.': [972, 1116], 'Christensen': [973], 'Mooney': [975], 'D.J.': [976, 1402, 1553], '154:': [983], '375-384Abstract': [984], '(584)': [992], 'Tumor': [995], 'regulated': [998, 1293], 'aberrant': [1000, 2285], 'production': [1001], 'angiogenic': [1003], 'anti-angiogenic': [1005], 'factors': [1006], 'expressed': [1007, 1049, 3909], 'both': [1008, 1618], 'malignant': [1010], 'host': [1013], '(15Fidler': [1015], 'Cell.': [1019, 1196, 2585], '79:': [1021], '185-188Abstract': [1022], '(1102)': [1028], '16Folkman': [1031], 'Nat.': [1033, 1706], 'Med.': [1034, 1096], '1:': [1036], '27-31Crossref': [1037], '(7235)': [1040], 'receptors': [1044], 'widely': [1048], 'on': [1050, 2208, 2248, 2758, 3182, 3446, 3458, 3755, 3813, 4155], 'normal': [1051], 'various': [1053], '(17Yang': [1056], 'S.K.': [1057, 2623, 2694, 2801, 2993, 3069, 3202, 3272, 3373], 'Eckmann': [1058], 'Panja': [1060], 'Kagnoff': [1062], 'M.F.': [1063], 'Gastroenterology.': [1064], '113:': [1066], '1214-1223Abstract': [1067], '(299)': [1075], '18Smith': [1078], 'Orringer': [1084], 'M.B.': [1085], 'Whyte': [1086], 'R.I.': [1087], 'Burdick': [1088], 'M.D.': [1089, 1143], 'Wilke': [1090], 'C.A.': [1091, 1151], 'Exp.': [1095, 1117, 1595], '179:': [1098], '1409-1415Crossref': [1099], '(360)': [1102], '19Singh': [1105], 'Varney': [1107], 'Ino': [1109], 'Vose': [1111], 'Bierman': [1113], 'Talmadge': [1115], 'Hematol.': [1118], '28:': [1120], '499-507Abstract': [1121], '(28)': [1129], '20Inoue': [1132], 'Slaton': [1134], 'J.W.': [1135, 1414, 1565, 1664], 'Eve': [1136], 'B.Y.': [1137], 'Kim': [1138, 1397, 1548], 'Perrotte': [1140], 'Balbay': [1142], 'Yano': [1144], 'S.': [1145, 1396, 1547, 1662, 2461, 2625], 'Bar-Eli': [1146, 1399, 1550], 'Radinsky': [1148], 'Pettaway': [1150], 'Dinney': [1152, 1403, 1554], 'C.P.': [1153, 1404, 1555], 'Clin.': [1154, 1405, 1556, 1594], 'Res.': [1156, 1251, 1407, 1558], '2104-2119PubMed': [1159], 'However': [1162, 2001], 'mechanisms': [1164, 2231], 'regulating': [1165], 'understood.': [1171], 'Among': [1172], 'variety': [1174], 'factors,': [1177], 'plays': [1179], 'critical': [1181], 'regulation': [1184, 1437, 2286], 'tumorigenesis': [1191, 1377], '(21Sen': [1192], 'Baltimore': [1194], '1998;': [1197, 1482, 1848, 1949, 2813, 3005, 3284, 3385], '47:': [1198], '921-928Abstract': [1199], '(1472)': [1204], '22Baeuerle': [1207], 'P.A.': [1208, 1222, 1323], 'Baichwal': [1209, 1324], 'V.R.': [1210, 1220, 1325], 'Adv.': [1211, 1326], '65:': [1214, 1329], '111-137Crossref': [1215, 1330], '23Baichwal': [1219], 'Baeuerle': [1221], 'Curr.': [1223], '7:': [1226, 1342], 'R94-R96Abstract': [1227], '24Surh': [1236], 'Y.J.': [1237], 'Chun': [1238], 'K.S.': [1239], 'Cha': [1240], 'Han': [1242], 'S.S.': [1243, 1249], 'Keum': [1244], 'Y.S.': [1245], 'Park': [1246], 'K.K.': [1247], 'Lee': [1248], 'Mutat.': [1250], '480': [1253], '–481:': [1254], '243-268Crossref': [1255], '(1456)': [1258], 'activated': [1263, 3657], 'endogenous': [1266], 'inducers': [1267, 3436], 'at': [1269, 2745, 2889, 3343, 3351, 3539, 3556, 3892, 3941, 3957, 4098, 4175, 4234], 'same': [1271, 3176], 'time': [1272, 3345, 4349], 'regulates': [1273], 'some': [1277], 'inducers.': [1280], 'For': [1281, 3018, 3034, 3409], 'example,': [1282], 'TNF-α': [1283, 1296], 'potent': [1286, 1516, 2060], 'NF-κB.': [1295, 2063, 2120, 2187, 2203, 2239, 2291, 3579, 3646, 3711, 3759, 3774], 'activates': [1297, 1830, 2019, 2222], 'NIK': [1302, 1691], 'IKK': [1305, 4324], 'thereby': [1307, 2185], 'phosphorylates': [1308], 'leads': [1311], 'subsequent': [1318, 4159, 4291], 'release': [1319], '(22Baeuerle': [1322], '25Aggarwal': [1334], 'B.B.': [1335, 2150, 2809, 3001, 3280, 3381], 'Natarajan': [1336], 'Eur.': [1338], 'Cytokine': [1339], 'Netw.': [1340], '1996;': [1341], '93-124PubMed': [1343], 'Once': [1346], 'activated,': [1349], 'it': [1350], 'drives': [1351], 'having': [1357], 'responsive': [1359], 'elements': [1360], 'within': [1361, 4189], 'their': [1362, 1885, 2568], 'promoters.': [1363], 'These': [1364, 2535, 3500], 'proinflammatory': [1366], 'TNF-α,': [1369], 'IL-1,': [1370, 1537], 'IFNγ,': [1371], 'Cox-2,': [1372], 'such': [1378, 2074, 3746], 'molecules,': [1381], 'matrix': [1382], 'metalloproteases,': [1383], '(26Karashima': [1389, 1540], 'Sweeney': [1391, 1542], 'Kamat': [1393, 1544], 'Huang': [1395, 1546], 'McConkey': [1401, 1552], '2003;': [1408, 1559, 1708, 1731, 1782, 1804, 2696], '9:': [1409, 1560], '2786-2797PubMed': [1410, 1561], '27Christman': [1413, 1564], 'Sadikot': [1415, 1566], 'R.T.': [1416, 1567], 'Blackwell': [1417, 1568], 'T.S.': [1418, 1569], 'Chest.': [1419, 1570], '117:': [1421, 1572], '1482-1487Abstract': [1422, 1573], '(309)': [1430, 1581], 'Several': [1433], 'production,': [1440], 'key': [1446], 'mediators': [1447], '(28Message': [1452], 'Johnston': [1454], '2004;': [1459, 1597, 1761, 1988, 2041, 2152, 3073, 3206], '75:': [1460], '5-17Crossref': [1461], '(134)': [1464], '29Brasier': [1467], 'Jamaluddin': [1469], 'Casola': [1471], 'Duan': [1473], 'Shen': [1475], 'Q.': [1476, 1693], 'Garofalo': [1477], 'R.P.': [1478], '273:': [1483, 2814, 3006, 3285, 3386], '3551-3661Abstract': [1484], '(147)': [1492], '30Yang': [1495], 'Chertov': [1497], 'O.': [1498], '69:': [1505], '691-697Crossref': [1506], 'As': [1510, 4223, 4334], 'discussed': [1511], 'earlier,': [1512], 'chemokine': [1517], 'cancer.': [1522], 'We': [1523], 'were': [1524, 2308, 2325, 2374, 2389, 2405, 2442, 2488, 2516, 2537, 2591, 2613, 2644, 2652, 2673, 2711, 2780, 2829, 2905, 3022, 3040, 3088, 3110, 3128, 3143, 3160, 3226, 3243, 3313, 3357, 3416, 3467, 3544, 3562, 3632, 3642, 3692, 3820, 3851, 3874, 3878, 3978, 4054, 4253, 4275, 4313, 4343], 'interested': [1525], 'determine': [1527, 2680, 3453, 3512, 3607, 4144, 4205], 'whether': [1528, 3513, 3608, 4145, 4206, 4306], 'can': [1530, 2225, 4308], 'similar': [1534, 3659, 4089], 'IL-10': [1539], '31Driessler': [1584], 'F.': [1585], 'Venstrom': [1586], 'Sabat': [1588], 'Asadullah': [1590], 'Schottelius': [1592], 'A.J.': [1593], '64-73Crossref': [1599], '(213)': [1602], 'only': [1608], 'TRAF': [1609], 'family': [1610], 'member': [1611], 'participates': [1613], 'signal': [1615, 3407], 'transduction': [1616], 'receptor': [1621, 1626, 1628, 2012], 'superfamily': [1622, 1630], 'IL-1': [1625, 1635, 1680, 2132], '(IL-1R)/Toll-like': [1627], '(TLR)': [1629], '(IRAK)': [1638, 2135], '(32Ye': [1639], 'Arron': [1641], 'Lamothek': [1643], 'Cirilli': [1645], 'Kobayashi': [1647], 'Shevdeq': [1649], 'N.K.': [1650], 'Segal': [1651], 'Dzivenu': [1653], 'O.K.': [1654], 'Vologodskaia': [1655], 'Yim': [1657], 'Duk': [1659], 'Pikeq': [1663], 'Darnay': [1665], 'B.G.': [1666], 'Choi': [1667], 'Y.': [1668, 1697, 1745, 1749, 1865, 2148, 2690, 3065, 3198], 'Wu': [1669], 'Nature.': [1671], '2002;': [1672], '418:': [1673], '443-447Crossref': [1674], '(541)': [1677], 'interacts': [1681], 'sequential': [1683], 'MyD': [1686], '88,': [1687], 'TRAF6,': [1689, 2483, 2852], '(33Huang': [1692], 'Yang': [1694], 'Lin': [1696], 'Walker': [1698], 'Cheng': [1700], 'Liu': [1702, 1858], 'Z.G.': [1703], 'Su': [1704], '5:': [1709], '98-103Crossref': [1710], '(228)': [1713], '34Jiang': [1716], 'Johnson': [1718], 'H.J.': [1719, 2803, 2995, 3274, 3375], 'Nie': [1720], 'Qin': [1722], 'Bird': [1724], 'T.A.': [1725], 'Li': [1726], 'X.': [1727, 1791, 2573], '278:': [1732], '10952-10956Abstract': [1733], '(150)': [1741], '35Yoshida': [1744], 'Koyama': [1748], 'Peng': [1750], 'Arman': [1752], 'Boch': [1754], 'J.A.': [1755], 'Auron': [1756], 'P.E.': [1757], '279:': [1762, 1989, 3074, 3207], '1768-1776Abstract': [1763], '(110)': [1771], '36Zhang': [1774], 'Jimi': [1776], 'E.': [1777, 2039], 'Bothwell': [1778], 'A.L.': [1779], '171:': [1783], '3620-3626Crossref': [1784], '(59)': [1787, 1919], '37Li': [1790], 'Tupper': [1792], 'J.C.': [1793], 'Bannerman': [1794], 'D.D.': [1795, 1899], 'Winn': [1796], 'Rhodes': [1798], 'C.J.': [1799], 'Harlan': [1800], 'Infect.': [1802], 'Immun.': [1803], '71:': [1805], '4414-4420Crossref': [1806], '(120)': [1809], 'finally': [1813, 2176], 'activate': [1814, 1893], 'IκB': [1815], 'kinases': [1816], '(IKKs)': [1817], '(MEKK)': [1825], '1,': [1826], 'turn': [1829], 'MAPK': [1831, 1840, 2085, 3331], '(MEK),': [1833], '(JNK),': [1837], 'p38': [1839], "(38O'Neill": [1841], 'Greene': [1843], '63:': [1849], '650-657Crossref': [1850], '(499)': [1853], '39Baud': [1856], 'V.': [1857], 'Z.-G.': [1859], 'Bennett': [1860], 'Suzuki': [1862], 'N.': [1863], 'Xia': [1864], 'Karin': [1866], 'Genes': [1868], 'Dev.': [1869], '13:': [1871], '1297-1308Crossref': [1872], '(409)': [1875], 'Chemoattractants': [1878], '(FMLP,': [1879], 'PAF,': [1880], 'C3a,': [1881], 'C5a)': [1883], 'bind': [1884, 3780], 'respective': [1886], 'seven': [1887], 'transmembrane-spanning': [1888], 'G-protein-coupled': [1889], 'receptors,': [1890], 'subsequently': [1892], '(40Browning': [1898], 'Pan': [1900, 1981], 'Z.K.': [1901, 1923, 1945, 1982], 'Prossnitz': [1902], 'E.R.': [1903], 'Ye': [1904, 1926, 1979], 'R.D.': [1905, 1927, 1980], '272:': [1910], '7995-8001Abstract': [1911], '41Pan': [1922], 'Kravchenko': [1924], 'V.V.': [1925], '270:': [1932], '7787-7790Abstract': [1933], '(67)': [1941, 2046], '42Pan': [1944], 'Biochim.': [1946], 'Biophys.': [1947], 'Acta.': [1948], '1443:': [1950], '90-98Crossref': [1951], '(39)': [1954], 'Formyl': [1957], 'phenylalanine': [1960], '(FMLP)-mediated': [1961], 'caused': [1966, 3602, 3612, 3670, 4048, 4151], 'stimulation': [1968], 'RhoA,': [1970], 'small': [1972], 'GTPase': [1973, 2197], 'activity': [1974, 2933, 2979, 3028, 3169, 3326, 3901, 3912, 3927, 3938, 3956, 4005, 4069, 4083], '(43Chen': [1975], 'L.Y.': [1976], 'Zuraw': [1977], 'B.L.': [1978], 'Rho': [1983], '7208-7212Abstract': [1990], '(18)': [1998], 'recent': [2003], 'suggests': [2005, 3595], "Kaposi's": [2007], 'sarcoma-associated': [2008], 'virus': [2009], 'G': [2010], 'protein-coupled': [2011], 'homologous': [2014], 'IL-8R': [2017], 'AP-1': [2020], 'CREB': [2022], 'via': [2023], 'Erk1/2': [2025], 'PI3K/Akt': [2027, 2035], 'pathways,': [2028], 'whereas': [2029, 2650], 'independent': [2033], '(44Cannon': [2036], 'Cesarman': [2038], 'Oncogene.': [2040, 2695], '23:': [2042], '514-523Crossref': [2043], 'study': [2051, 2515, 3442], 'clearly': [2053], 'demonstrate': [2054, 2161], 'acts': [2057], 'activator': [2061], 'Cox-2.': [2079], 'JNK': [2083, 3260, 3325], 'time-': [2088], 'concentration-dependent': [2090], 'induction': [2093, 2194, 3935, 3953, 3969, 4078], 'was': [2096, 2105, 2335, 2343, 2455, 2684, 2753, 2767, 2795, 2887, 2924, 2929, 2956, 2973, 2980, 3029, 3056, 3153, 3172, 3187, 3262, 3321, 3489, 3528, 3620, 3777, 3902, 3939, 4006, 4070, 4150, 4167, 4187, 4221, 4325], 'influenced': [2098], 'DN-TRADD,': [2100], '-FADD,': [2101], '-TRAF2': [2103], 'DN-TRAF6,': [2108], '-NIK,': [2109], '-IKK,': [2111], 'indicating': [2112, 3770, 4039, 4198, 4256, 4277], 'involvement': [2113, 2266], 'From': [2121], 'results': [2123, 2274, 3501, 3571, 3648, 3918, 4362], 'obtained': [2125, 2309, 2326, 2336, 2344, 2390, 2406, 2538], 'using': [2128, 3327, 3359, 4329], 'DN': [2130], 'constructs,': [2131], 'knock-out': [2136, 2548, 2564, 2641], 'cells,': [2137, 2565, 3298, 3334], '(TRAF6-BP),': [2141], 'inhibits': [2143], 'TRAF6-mediated': [2144], 'signaling': [2146], '(45Takada': [2147], 'Aggarwal': [2149, 2495, 2808, 3000, 3279, 3380], '104:': [2153], '4113-4121Crossref': [2154], '(10)': [2157], 'might': [2164, 2260], 'function': [2165], 'NIK,': [2174, 2484, 2853], 'leading': [2177], 'activating': [2186], 'mediates': [2189], 'action': [2191], 'FMLP': [2200], 'With': [2204], 'already': [2205], 'existing': [2206], 'importance': [2210], 'our': [2218, 2273, 3426], 'finding': [2219], 'say': [2226], 'providing': [2245], 'activation,': [2251, 2682, 3523], 'unlike': [2252], 'other': [2253], 'chemoattractants,': [2254], 'IRAK-TRAF6': [2257], 'helpful': [2262], 'understanding': [2264], 'new': [2270], 'vascularization.': [2271], 'Further': [2272], 'make': [2275], 'therapeutic': [2279], 'target': [2280], 'diseases': [2282], 'involving': [2283], 'either': [2288, 2988, 3118, 3301, 3337, 3714], 'Materials—Glycine,': [2292], 'dithiothreitol,': [2293], 'leupeptin,': [2294], 'phenylmethylsulfonyl': [2296], 'fluoride,': [2297], 'aprotinin,': [2298], '4-methyl': [2299], 'umbelliferyl': [2300], 'phosphate,': [2301], 'bovine': [2302, 2323, 2662], 'serum': [2303, 2324, 3742], 'albumin,': [2304], 'anti-tubulin': [2306, 4264], 'antibody': [2307, 3236, 3365, 3535, 3551, 3581, 3624, 3638, 3993, 4023], 'from': [2310, 2327, 2337, 2345, 2376, 2391, 2407, 2539, 2615, 2675, 2720, 2755, 3031, 3139, 3174, 3688, 4008, 4084], 'Sigma.': [2311], 'Penicillin,': [2312], 'streptomycin,': [2313], 'RPMI': [2314, 2647], '1640': [2315, 2648], 'medium,': [2316, 2320], "Dulbecco's": [2317, 2654], 'modified': [2318, 2655, 3266], "Eagle's": [2319, 2656], 'fetal': [2322, 2661], 'Invitrogen': [2328], 'Life': [2329], 'Technologies': [2330, 2394], '(Grand': [2331], 'Island,': [2332], 'NY).': [2333], 'Pharmingen': [2338], '(San': [2339], 'Diego,': [2340], 'CA).': [2341, 2382, 2942], 'Peprotech': [2346], '(Rocky': [2347], 'Hill,': [2348], 'NJ).': [2349], 'Antibodies': [2350, 2383], 'against': [2351, 2384, 4215], 'IL-1R1,': [2352], 'IL-1R2,': [2353], 'IL-8R,': [2355], 'TLR4,': [2356], 'p65,': [2357, 2473], 'IKKα,': [2358], 'c-Rel,': [2360], 'CRM1,': [2365], 'double-stranded': [2369, 2717], 'Oct1': [2370], 'gel': [2371], 'oligonucleotide': [2373, 2757], 'purchased': [2375], 'Santa': [2377], 'Cruz': [2378], 'Biotechnology': [2379], '(Santa': [2380], 'Cruz,': [2381], 'phospho-IκBα,': [2386], 'phospho-MAPK': [2388], 'Cell': [2392, 2508, 2921, 3141], 'Signaling': [2393], '(Beverly,': [2395], 'MA).': [2396], 'Mounting': [2397], 'medium': [2398, 2649, 2657, 2843, 2923, 3247], 'DAPI': [2400, 3249], 'goat-anti-rabbit': [2402], 'IgG': [2403], '(Alexa-Fluor-conjugated)': [2404], 'Molecular': [2408], 'Probes': [2409], '(Eugene,': [2410], 'OR).': [2411], 'Cell-permeable': [2412], 'Kaposi': [2416], 'fibroblast': [2417], 'leader': [2420, 2423, 2433], 'sequence': [2421, 2424, 2434], '(AAVALLPAVLLALLAP-RKIPTEDEYTDRPSQPST;': [2422], 'italics),': [2426], 'mutant': [2429, 3710], '(AAVALLPAVLLALLAP-RKIATADEATDRPSQPST;': [2432], 'italics': [2436], 'mutated': [2438], 'amino': [2439], 'acids': [2440], 'underlined)': [2441], 'chemically': [2443], 'synthesized': [2444], 'purified': [2446], 'high': [2448], 'performance': [2449], 'liquid': [2450], 'chromatography.': [2451], 'Recombinant': [2452], 'toxin': [2454], 'kindly': [2456, 2489, 2592], 'provided': [2457, 2593], 'Prof.': [2459, 2492], 'Chhatwal': [2462], '(German': [2463], 'Center': [2464], 'Biotechnology,': [2466], 'Braunschweig,': [2467], 'Germany).': [2468], 'plasmid': [2470, 2846, 2898, 3100, 3825], 'constructs': [2471, 2478], 'NF-κB-SEAP,': [2474], 'Cox-2-luciferase,': [2475], 'supplied': [2490], 'University': [2498], 'Texas': [2500], 'Anderson': [2503], 'Center,': [2505], 'Houston,': [2506], 'TX.': [2507], 'Lines—The': [2509], 'lines': [2511], 'follows:': [2518], 'U-937': [2519, 2827, 3086, 3414, 3462, 3496, 3509, 3542, 3630, 3690, 3818, 3849, 4184, 4311], '(histiocytic': [2520], 'lymphoma),': [2521], 'HeLa': [2522], '(epithelial': [2523], 'cells),': [2524, 2527, 2530], 'THP1': [2525], '(monocytic': [2526], 'H4': [2528], '(glial': [2529], 'RAW264.7': [2532], '(mouse': [2533], 'macrophages).': [2534], 'American': [2540], 'Type': [2541], 'Culture': [2542], 'Collection': [2543], '(Manassas,': [2544], 'VA).': [2545], 'HEK293': [2549, 2642], '(lacks': [2551], 'mRNA)': [2555], 'IRAK-reconstituted': [2557, 2639], '(restoration': [2559], 'restored': [2567], 'responsiveness': [2569], 'IL-1)': [2571], '(46Li': [2572], 'Commane': [2574], 'Burns': [2576], 'Vithalani': [2578], 'Cao': [2580], 'Stark': [2582], 'G.R.': [2583], 'Mol.': [2584], '19:': [2588], '464-4652Google': [2589], 'Dr.': [2595], 'Xiaoxia': [2596], 'Li,': [2597], 'Dept.': [2598], 'Immunology,': [2600], 'Lerner': [2601], 'Research': [2602], 'Institute,': [2603], 'Cleveland,': [2604], 'OH.': [2605], 'Peripheral': [2606], '(PBMC)': [2610], 'isolated': [2614], 'fresh': [2616], 'Ficoll-Hipaque': [2620], 'method': [2621, 3192, 3267], '(47Manna': [2622], 'Samanta': [2624, 2626], 'A.K.': [2627], '159:': [2631], '5042-5052Crossref': [2632], 'U-937,': [2636], 'THP-1,': [2637], 'cultured': [2645, 2907], 'others': [2651], 'supplemented': [2658], '10%': [2660], 'serum,': [2663], 'penicillin': [2664], '(100': [2665, 2669, 3311, 3349, 3887, 4180, 4317], 'units/ml),': [2666], 'streptomycin': [2668], 'μg/ml).': [2670], 'All': [2671], 'free': [2674, 2756], 'mycoplasma.': [2676], 'Activation': [2678], 'Assay—To': [2679], 'EMSA': [2683], 'conducted': [2685], 'essentially': [2686, 2934], 'described': [2688, 2798, 3060, 3194, 3269], '(48Sreenivasan': [2689], 'Sarkar': [2691], 'Manna': [2693, 3068, 3201], '22:': [2697], '4356-4369Crossref': [2698], 'Briefly,': [2704, 2826, 3222, 3297], '8': [2705], 'μg': [2706, 2858, 2863, 2891, 3097, 3103, 3532, 3995], 'extract': [2709, 3318], 'proteins': [2710, 4166], 'incubated': [2712, 3144, 3230, 3468, 3529, 3546, 3621, 3693, 3979], '32P': [2714], 'end-labeled': [2715], '45-mer': [2716], 'oligonucleotides': [2719], 'HIV-LTR,': [2721], '5′-TTG': [2722], 'TTA': [2723], 'CAA': [2724], 'GGG': [2725], 'ACT': [2726], 'TTC': [2727], 'CGC': [2728], 'TGG': [2729], 'GGA': [2730], 'CTT': [2731], 'TCC': [2732], 'AGG': [2733], 'GAG': [2734], 'GCG': [2735], 'TGG-3′': [2736], '(bold': [2737], 'indicates': [2738], 'site)': [2741], '30': [2743, 4237], 'min': [2744, 4177, 4197, 4238, 4246], '37': [2746, 3352, 3540, 3557, 3893], '°C,': [2747], 'complex': [2751, 3733, 3761], 'formed': [2752], 'separated': [2754], '6.6%': [2759], 'native': [2760], 'polyacrylamide': [2761], 'gels.': [2762], 'specificity': [2764, 3678, 3772], 'examined': [2768, 3188, 3402, 4168], 'competition': [2770], 'unlabeled': [2772], 'oligonucleotides.': [2773], 'Visualization': [2774], 'quantitation': [2776], 'radioactive': [2778], 'bands': [2779, 4252, 4342], 'done': [2781], 'indicated': [2783], 'above.': [2784], 'Reporter': [2786, 3047, 3793], 'Gene': [2787, 3048, 3794], 'Transcription': [2788], 'Assay—The': [2789], 'measured': [2796], 'previously': [2799], '(49Manna': [2800, 2992, 3271, 3372], 'Zhang': [2802, 2994, 3273, 3374], 'Yan': [2804, 2996, 3275, 3376], 'Oberley': [2806, 2998, 3277, 3378], 'L.W.': [2807, 2999, 3278, 3379], '13245-13254Abstract': [2815, 3007, 3286, 3387], '(523)': [2823, 3015, 3294, 3395], 'transiently': [2830, 3089, 3821], 'Qiagen': [2833], 'SuperFect': [2834, 3092], 'transfection': [2835, 2955, 3019, 3035, 3093, 4103], 'reagent': [2836, 3094], '(Hilden,': [2837], 'Germany)': [2838], '1': [2840, 3096, 3531, 3537, 3626, 3998], 'ml': [2841], 'containing': [2844], 'DNAs': [2847], '(1': [2857, 3994], 'each)': [2859], 'along': [2860], '0.5': [2862, 3102], 'promoter': [2866], 'DNA': [2867, 2886], 'linked': [2868, 3826], 'heat-stable': [2871], 'phosphatase': [2874], '(SEAP)': [2875], '(GFP)': [2880], 'constructs.': [2881], 'total': [2883], 'amount': [2884], 'maintained': [2888], '3': [2890, 2902, 3107, 3839], 'control': [2897, 2967, 4104], 'pCMVFLAG1': [2899], 'DNA.': [2900], 'After': [2901, 3106], 'h,': [2903, 2910, 3108, 3627], 'washed,': [2906], '12': [2909, 3845], 'then': [2912, 2957, 3545, 3629, 3643], 'treated': [2913], '24': [2919, 3123, 3890, 4001], 'h.': [2920, 3124, 3846, 4002], 'culture-conditioned': [2922], 'harvested,': [2925], '25': [2927], 'μl': [2928], 'analyzed': [2930, 3255], 'SEAP': [2932, 2978, 3829, 3862, 3866, 3900, 3926, 3937, 3955, 4004, 4017, 4035, 4068, 4077], 'per': [2936, 4094], 'Clontech': [2938], 'protocol': [2939], '(Palo': [2940], 'Alto,': [2941], 'average': [2944], 'number': [2945], '(±': [2946], 'S.D.)': [2947], 'relative': [2949], 'light': [2951], 'units': [2952], 'each': [2954, 3032, 3996, 4106], 'determined': [2958], 'reported': [2960], 'fold': [2962, 3163, 3911], 'respect': [2965], 'vector-transected': [2968], 'system': [2972], 'specific,': [2974], 'because': [2975], 'TNF-induced': [2976, 4043], 'overexpression': [2983], 'mutants': [2986], 'lacking': [2987], 'Ser32': [2989], 'Ser36': [2991], 'control,': [3020], 'co-transfected': [3023, 3090], 'β-galactosidase,': [3025], 'assayed': [3030, 3173, 3263, 3358, 3480, 3565, 3644, 3903, 4007, 4326], 'transfection.': [3033], 'efficiency,': [3036], 'GFP-positive': [3038, 3848], 'counted': [3041, 3852], 'under': [3042, 3256, 3853], 'microscope.': [3045, 3259], 'Cox-2-dependent': [3046], 'Transcription—IL-8-': [3049], 'TNF-dependent': [3051], 'luciferase': [3052, 3136], 'carried': [3057], 'out': [3058], 'before': [3061], '(50Sarkar': [3062, 3195], 'Sreenivasan': [3064, 3197], 'Ramesh': [3066, 3199], 'G.T.': [3067, 3200], '33768-33781Abstract': [3075, 3208], '(109)': [3083, 3216], 'Cox-2-luciferase': [3099], 'β-galactosidase.': [3105], 'washed': [3111], 'stimulated': [3113, 3299, 3335, 3633, 3879, 4055, 4314], 'concentrations': [3116, 3303, 3339, 3429, 3471, 3882], 'pellets': [3127], 'extracted': [3129, 4281], 'lysis': [3131], 'buffer': [3132], '(part': [3133], 'assay': [3137], 'kit': [3138], 'Promega).': [3140, 3150], 'extracts': [3142, 3479, 3561, 3641, 3687, 4086], 'firefly': [3147], 'luciferin': [3148], '(substrate,': [3149], 'Light': [3151], 'emission': [3152], 'monitored': [3154], 'luminometer,': [3157], 'values': [3159], 'calculated': [3161], 'over': [3165, 3913], 'vector-transfected': [3166], 'value.': [3167], 'β-galactosidase': [3171, 4082], 'extracts.': [3177], 'Immunocytochemistry—The': [3178], 'effect': [3179, 3445, 3455, 3754, 4154], 'translocation': [3184, 4115], 'immunocytochemical': [3191], 'slight': [3220], 'modifications.': [3221], 'after': [3223], 'treatment': [3224, 4182], 'fixed,': [3227], 'permeabilized,': [3228], 'rabbit': [3232], 'polyclonal': [3233], 'anti-human': [3234], 'goat': [3239], 'anti-rabbit': [3240], 'IgG-Alex-Fluor.': [3241], 'Cells': [3242, 3877], 'mounted': [3244], 'mounting': [3246], '(to': [3250], 'counterstain': [3251], 'nucleus)': [3253], 'fluorescence': [3258], 'Assay—JNK': [3261], 'earlier': [3270], 'times': [3308], 'ng/ml)': [3312, 3350, 4181, 4318], 'extracted,': [3314], '(250': [3319], 'μg/treatment)': [3320], 'detect': [3324, 3482, 3674, 3808], 'GST-Jun': [3328], 'substrate.': [3330], 'Kinase': [3332], 'Assay—U-937': [3333], 'periods': [3346], '°C': [3353, 3894], 'phosphorylated': [3355, 4230], 'phosphospecific': [3360], 'anti-p44/42': [3361], '(Thr202/Tyr204)': [3364], '(New': [3366], 'England': [3367], 'Biolabs)': [3368], 'Western': [3370, 4170, 4211], 'blot': [3371, 4212], 'study,': [3400], 'transduction.': [3408], 'studies,': [3413], 'used,': [3417], 'since': [3418], 'have': [3421, 3796], 'been': [3422], 'characterized': [3424], 'laboratory.': [3427], 'duration': [3431], 'exposure': [3433], 'chemicals': [3438], 'employed': [3439], 'had': [3443, 3752], 'no': [3444, 3952], 'viability.': [3448], 'Induces': [3450, 3791, 4109, 4284], 'Activation—To': [3452], '(2': [3464], '×': [3465], '106/ml)': [3466], '2': [3475, 3554], 'h': [3476, 3538, 3555, 3840, 3891], 'EMSA.': [3485, 3569], 'shown': [3490, 3797, 4224, 4335], '(Fig.': [3498, 3726, 4037, 4072, 4202], '1A).': [3499], 'potently': [3507], 'To': [3511, 3606, 3673, 3807, 4143, 4204], 'induced': [3515, 3578, 3681, 3925, 4034], 'band': [3517, 3682, 3720, 4193, 4232, 4270, 4358], 'due': [3519], '100': [3524, 3946, 3963, 4057], 'ng': [3525], 'anti-IL-8': [3534], '°C.': [3541, 3558], 'mixture': [3552, 3990, 4020], 'prepared': [3563], 'show': [3572, 3652, 3922], 'Fig.': [3574, 3650, 3920, 4226, 4337], '1B': [3575], 'Anti-IL-8': [3580], 'alone': [3582, 3987], 'combination': [3585, 3703], 'did': [3588, 4031], 'induce': [3590, 4309], 'activation.': [3592], 'result': [3594], 'endotoxin,': [3618], 'anti-TLR': [3623, 3654], 'anti-TLR4': [3637, 3992, 4022], 'mixture.': [3639], 'Nuclear': [3640], '1C': [3651], 'antibody-preincubated': [3655], 'alone,': [3662], 'suggesting': [3663, 3729, 3787, 3966, 4075, 4101], 'endotoxin.': [3672, 4050], 'composition': [3676], 'visualized': [3683], 'IL-8-activated': [3689, 3732], 'Abs': [3695, 3712, 3745], 'p50': [3696, 3736], '(NF-κBI),': [3697], '(Rel': [3699], 'A),': [3700], '50-fold': [3705], 'excess': [3706], 'cold': [3708, 3768], 'shifted': [3718], 'higher': [3723], 'size': [3725], '1D),': [3727], 'thus': [3728], 'consisted': [3734], 'subunits.': [3739], 'Neither': [3740], 'pre-immune': [3741], 'nor': [3743], 'irrelevant': [3744], 'anti-c-Rel': [3748], 'anti-cyclin': [3750], 'D1': [3751], 'any': [3753, 3958], 'completely': [3762], 'disappeared': [3763], 'presence': [3766], 'Mutant': [3775], 'unable': [3778], 'complex,': [3785], 'further': [3786, 4074], 'specificity.': [3789], 'Expression—We': [3795], 'types.': [3806], 'expression,': [3817], 'NF-κB-containing': [3824], 'GFP': [3831, 3868], 'construct': [3832], 'without': [3835], 'IκBα-DN': [3836], 'plasmids': [3837], 'culture': [3843, 3905, 4009], 'microscope': [3856], '23': [3858], '22%': [3860], '+': [3863, 3867, 3869], 'GFP-': [3864], 'IκBα-DN-transfected': [3870, 3949], 'pool': [3871], 'found,': [3875], 'respectively.': [3876], 'pm)': [3888], 'CO2': [3897], 'incubator.': [3898], 'supernatant.': [3906, 4010], 'Results': [3907], 'nontransfected': [3915], 'control.': [3916], '1E': [3921], 'manner,': [3931], 'about': [3933], '5-fold': [3934], '1000': [3942], 'ng/ml': [3943, 4058], 'pm': [3947, 3964], 'TNF.': [3948], 'showed': [3951, 4087], 'concentration': [3959], 'mediated': [3968], 'transcription.': [3974], 'SEAP-transfected': [3976], 'serum-activated': [3984], 'LPS': [3985], '(SA-LPS)': [3986], 'h)': [3999], 'Then': [4003], 'SA-LPS': [4015, 4030], 'increased': [4016, 4344], 'activities.': [4018], 'block': [4033], 'activities': [4036], '1F1)': [4038], 'IL-8-': [4041], 'When': [4051], 'times,': [4062, 4321], '1F),': [4073], 'IL-8.': [4080], 'almost': [4088], 'reduction': [4090], 'absorbance': [4092], '(as': [4093], 'Promega': [4096], 'protocol)': [4097], '420': [4099], 'nm,': [4100], 'treatment.': [4107], 'Phosphorylation': [4110], 'Degradation': [4112], 'IκBα—The': [4114], 'nucleus': [4120], 'preceded': [4122], 'phosphorylation,': [4125, 4210], 'ubiquitination,': [4126], 'proteolytic': [4128], '(51Coliins': [4132], 'Bioessays.': [4134], '21:': [4136], '238-244Crossref': [4137], '(288)': [4140], 'degradation,': [4160, 4292], 'level': [4163], 'blot.': [4171], 'started': [4174], '60': [4176, 4243], 'completed': [4188], '90': [4190, 4245], 'min.': [4191, 4352], 'reappeared': [4194], '120': [4196], 'resynthesis': [4201], '2A).': [4203], 'antibodies': [4214], 'serine-phosphorylated': [4217], 'form': [4218], 'performed.': [4222], '2A,': [4227], 'middle': [4228], 'panel,': [4229], 'appeared': [4233], '15': [4235], 'stimulation.': [4241], 'At': [4242, 4353], 'incubation,': [4249], 'visible,': [4255], 'degradation.': [4258], 'Upon': [4259], 'reprobing': [4260], 'membrane': [4262], 'antibody,': [4265], 'found': [4267], 'intensities': [4271], 'all': [4273], 'lanes': [4274], 'uniform,': [4276], 'equal': [4278], 'loading': [4279], 'protein.': [4282, 4333], 'IKK—As': [4285], 'events': [4295], 'occur': [4296], 'upstream': [4301], 'kinase,': [4302], 'vitro': [4328], 'GST-IκBα': [4330, 4341], 'substrate': [4332], '2B,': [4338], 'radiolabeled': [4340], 'increasing': [4346], 'incubation': [4348], 'until': [4350], '45': [4351], 'later': [4355], 'time,': [4356], 'decreased': [4359], 'dramatically.': [4360], 'indu': [4366]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2069544210', 'counts_by_year': [{'year': 2024, 'cited_by_count': 4}, {'year': 2023, 'cited_by_count': 4}, {'year': 2022, 'cited_by_count': 8}, {'year': 2021, 'cited_by_count': 8}, {'year': 2020, 'cited_by_count': 9}, {'year': 2019, 'cited_by_count': 7}, {'year': 2018, 'cited_by_count': 4}, {'year': 2017, 'cited_by_count': 7}, {'year': 2016, 'cited_by_count': 6}, {'year': 2015, 'cited_by_count': 6}, {'year': 2014, 'cited_by_count': 7}, {'year': 2013, 'cited_by_count': 6}, {'year': 2012, 'cited_by_count': 8}], 'updated_date': '2024-12-22T16:18:39.077961', 'created_date': '2016-06-24'}