The Chemotactic Action of Urokinase on Smooth Muscle Cells Is Dependent on Its Kringle Domain

Name: Work Video:
Duration: 3 min 30 s
Svetlana Mukhina; Victoria Stepanova; Dmitri Traktouev; Alexei Poliakov; R.Sh. Beabealashvilly; Yaroslav Gursky; Mikhail Minashkin; Alexander Shevelev; Tkachuk Va
{'id': 'https://openalex.org/W2028798638', 'doi': 'https://doi.org/10.1074/jbc.m909080199', 'title': 'The Chemotactic Action of Urokinase on Smooth Muscle Cells Is Dependent on Its Kringle Domain', 'display_name': 'The Chemotactic Action of Urokinase on Smooth Muscle Cells Is Dependent on Its Kringle Domain', 'publication_year': 2000, 'publication_date': '2000-06-01', 'ids': {'openalex': 'https://openalex.org/W2028798638', 'doi': 'https://doi.org/10.1074/jbc.m909080199', 'mag': '2028798638', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/10749881'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m909080199', 'pdf_url': 'http://www.jbc.org/article/S0021925819802284/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925819802284/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5071799285', 'display_name': 'Svetlana Mukhina', 'orcid': 'https://orcid.org/0000-0002-9995-479X'}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Svetlana Mukhina', 'raw_affiliation_strings': ['Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia.'], 'affiliations': [{'raw_affiliation_string': 'Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia.', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5019915439', 'display_name': 'Victoria Stepanova', 'orcid': 'https://orcid.org/0000-0002-9313-5742'}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Victoria Stepanova', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5015445114', 'display_name': 'Dmitri Traktouev', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Dmitri Traktouev', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5072741116', 'display_name': 'Alexei Poliakov', 'orcid': 'https://orcid.org/0000-0001-7428-4040'}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Alexei Poliakov', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5062496401', 'display_name': 'R.Sh. Beabealashvilly', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Robert Beabealashvilly', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5111810819', 'display_name': 'Yaroslav Gursky', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Yaroslav Gursky', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5034584071', 'display_name': 'Mikhail Minashkin', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Mikhail Minashkin', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5020544439', 'display_name': 'Alexander Shevelev', 'orcid': 'https://orcid.org/0000-0003-4305-4132'}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Alexander Shevelev', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5035482823', 'display_name': 'Tkachuk Va', 'orcid': 'https://orcid.org/0000-0002-7492-747X'}, 'institutions': [{'id': 'https://openalex.org/I4210089595', 'display_name': 'Institute of Experimental Cardiology', 'ror': 'https://ror.org/00bw4xw30', 'country_code': 'RU', 'type': 'facility', 'lineage': ['https://openalex.org/I1318325419', 'https://openalex.org/I4210089595']}], 'countries': ['RU'], 'is_corresponding': False, 'raw_author_name': 'Vsevolod Tkachuk', 'raw_affiliation_strings': ['From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia'], 'affiliations': [{'raw_affiliation_string': 'From the Institute of Experimental Cardiology, Cardiology Research Center, Moscow 121552, Russia', 'institution_ids': ['https://openalex.org/I4210089595']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 1, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 4.538, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 111, 'citation_normalized_percentile': {'value': 0.915712, 'is_in_top_1_percent': False, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 96, 'max': 97}, 'biblio': {'volume': '275', 'issue': '22', 'first_page': '16450', 'last_page': '16458'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T10620', 'display_name': 'Protease and Inhibitor Mechanisms', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1306', 'display_name': 'Cancer Research'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T10620', 'display_name': 'Protease and Inhibitor Mechanisms', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1306', 'display_name': 'Cancer Research'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11917', 'display_name': 'Coagulation, Bradykinin, Polyphosphates, and Angioedema', 'score': 0.998, 'subfield': {'id': 'https://openalex.org/subfields/2716', 'display_name': 'Genetics'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}, {'id': 'https://openalex.org/T10881', 'display_name': 'Blood Coagulation and Thrombosis Mechanisms', 'score': 0.9942, 'subfield': {'id': 'https://openalex.org/subfields/2720', 'display_name': 'Hematology'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/kringle-domain', 'display_name': 'Kringle domain', 'score': 0.8501797}], 'concepts': [{'id': 'https://openalex.org/C56219504', 'wikidata': 'https://www.wikidata.org/wiki/Q7900869', 'display_name': 'Urokinase receptor', 'level': 3, 'score': 0.9057438}, {'id': 'https://openalex.org/C37600318', 'wikidata': 'https://www.wikidata.org/wiki/Q24726526', 'display_name': 'Kringle domain', 'level': 4, 'score': 0.8501797}, {'id': 'https://openalex.org/C54166955', 'wikidata': 'https://www.wikidata.org/wiki/Q658145', 'display_name': 'Chemotaxis', 'level': 3, 'score': 0.8184972}, {'id': 'https://openalex.org/C2776892390', 'wikidata': 'https://www.wikidata.org/wiki/Q7119591', 'display_name': 'Urokinase', 'level': 2, 'score': 0.750504}, {'id': 'https://openalex.org/C2779679481', 'wikidata': 'https://www.wikidata.org/wiki/Q13581432', 'display_name': 'Plasminogen activator', 'level': 2, 'score': 0.5569644}, {'id': 'https://openalex.org/C143065580', 'wikidata': 'https://www.wikidata.org/wiki/Q3285695', 'display_name': 'Mutant', 'level': 3, 'score': 0.52269804}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.49564588}, {'id': 'https://openalex.org/C2781071845', 'wikidata': 'https://www.wikidata.org/wiki/Q21173374', 'display_name': 'Plasmin', 'level': 3, 'score': 0.49438095}, {'id': 'https://openalex.org/C153911025', 'wikidata': 'https://www.wikidata.org/wiki/Q7202', 'display_name': 'Molecular biology', 'level': 1, 'score': 0.4419397}, {'id': 'https://openalex.org/C170493617', 'wikidata': 'https://www.wikidata.org/wiki/Q208467', 'display_name': 'Receptor', 'level': 2, 'score': 0.4407539}, {'id': 'https://openalex.org/C107824862', 'wikidata': 'https://www.wikidata.org/wiki/Q616005', 'display_name': 'Binding site', 'level': 2, 'score': 0.42701495}, {'id': 'https://openalex.org/C95444343', 'wikidata': 'https://www.wikidata.org/wiki/Q7141', 'display_name': 'Cell biology', 'level': 1, 'score': 0.41610137}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.35407835}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.33382022}, {'id': 'https://openalex.org/C134018914', 'wikidata': 'https://www.wikidata.org/wiki/Q162606', 'display_name': 'Endocrinology', 'level': 1, 'score': 0.091814935}, {'id': 'https://openalex.org/C104317684', 'wikidata': 'https://www.wikidata.org/wiki/Q7187', 'display_name': 'Gene', 'level': 2, 'score': 0.089193165}, {'id': 'https://openalex.org/C181199279', 'wikidata': 'https://www.wikidata.org/wiki/Q8047', 'display_name': 'Enzyme', 'level': 2, 'score': 0.088558644}, {'id': 'https://openalex.org/C54355233', 'wikidata': 'https://www.wikidata.org/wiki/Q7162', 'display_name': 'Genetics', 'level': 1, 'score': 0.06782773}], 'mesh': [{'descriptor_ui': 'D002633', 'descriptor_name': 'Chemotaxis', 'qualifier_ui': 'Q000187', 'qualifier_name': 'drug effects', 'is_major_topic': True}, {'descriptor_ui': 'D018082', 'descriptor_name': 'Kringles', 'qualifier_ui': 'Q000502', 'qualifier_name': 'physiology', 'is_major_topic': True}, {'descriptor_ui': 'D009130', 'descriptor_name': 'Muscle, Smooth', 'qualifier_ui': 'Q000187', 'qualifier_name': 'drug effects', 'is_major_topic': True}, {'descriptor_ui': 'D014568', 'descriptor_name': 'Urokinase-Type Plasminogen Activator', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': True}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002460', 'descriptor_name': 'Cell Line', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002633', 'descriptor_name': 'Chemotaxis', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006801', 'descriptor_name': 'Humans', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D018082', 'descriptor_name': 'Kringles', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009130', 'descriptor_name': 'Muscle, Smooth', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009130', 'descriptor_name': 'Muscle, Smooth', 'qualifier_ui': 'Q000166', 'qualifier_name': 'cytology', 'is_major_topic': False}, {'descriptor_ui': 'D016296', 'descriptor_name': 'Mutagenesis', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011485', 'descriptor_name': 'Protein Binding', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000235', 'qualifier_name': 'genetics', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': False}, {'descriptor_ui': 'D014568', 'descriptor_name': 'Urokinase-Type Plasminogen Activator', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D014568', 'descriptor_name': 'Urokinase-Type Plasminogen Activator', 'qualifier_ui': 'Q000235', 'qualifier_name': 'genetics', 'is_major_topic': False}, {'descriptor_ui': 'D014568', 'descriptor_name': 'Urokinase-Type Plasminogen Activator', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m909080199', 'pdf_url': 'http://www.jbc.org/article/S0021925819802284/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/10749881', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m909080199', 'pdf_url': 'http://www.jbc.org/article/S0021925819802284/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 73, 'referenced_works': ['https://openalex.org/W12043496', 'https://openalex.org/W130026199', 'https://openalex.org/W1482629448', 'https://openalex.org/W1485224770', 'https://openalex.org/W1493910160', 'https://openalex.org/W1494456818', 'https://openalex.org/W1495239533', 'https://openalex.org/W1540038532', 'https://openalex.org/W1578346366', 'https://openalex.org/W1579348184', 'https://openalex.org/W1591097516', 'https://openalex.org/W1602370661', 'https://openalex.org/W1605718906', 'https://openalex.org/W1670027677', 'https://openalex.org/W1806791563', 'https://openalex.org/W1809802001', 'https://openalex.org/W1875615308', 'https://openalex.org/W1971097782', 'https://openalex.org/W1988367469', 'https://openalex.org/W1989566582', 'https://openalex.org/W1996015396', 'https://openalex.org/W1997510218', 'https://openalex.org/W2000777358', 'https://openalex.org/W2002387352', 'https://openalex.org/W2003593894', 'https://openalex.org/W2009787256', 'https://openalex.org/W2011351558', 'https://openalex.org/W2012710893', 'https://openalex.org/W2014078232', 'https://openalex.org/W2017197947', 'https://openalex.org/W2019728202', 'https://openalex.org/W2023584818', 'https://openalex.org/W2024327925', 'https://openalex.org/W2028093783', 'https://openalex.org/W2036443538', 'https://openalex.org/W2037328062', 'https://openalex.org/W2037804965', 'https://openalex.org/W2038260402', 'https://openalex.org/W2042155824', 'https://openalex.org/W2043352260', 'https://openalex.org/W2043513099', 'https://openalex.org/W2043813981', 'https://openalex.org/W2046552422', 'https://openalex.org/W2055114143', 'https://openalex.org/W2057279293', 'https://openalex.org/W2059075122', 'https://openalex.org/W2062584167', 'https://openalex.org/W2063627953', 'https://openalex.org/W2064657225', 'https://openalex.org/W2065458605', 'https://openalex.org/W2066917018', 'https://openalex.org/W2069044499', 'https://openalex.org/W2072928113', 'https://openalex.org/W2076924796', 'https://openalex.org/W2079297926', 'https://openalex.org/W2082782963', 'https://openalex.org/W2082845257', 'https://openalex.org/W2082939913', 'https://openalex.org/W2089840669', 'https://openalex.org/W2100404293', 'https://openalex.org/W2103031848', 'https://openalex.org/W2117702027', 'https://openalex.org/W2121300516', 'https://openalex.org/W2121799544', 'https://openalex.org/W2127611014', 'https://openalex.org/W2136319177', 'https://openalex.org/W2148745193', 'https://openalex.org/W2148803067', 'https://openalex.org/W2165437268', 'https://openalex.org/W2167423680', 'https://openalex.org/W2171774285', 'https://openalex.org/W2399096650', 'https://openalex.org/W2402651214'], 'related_works': ['https://openalex.org/W3199539111', 'https://openalex.org/W2946587884', 'https://openalex.org/W2578084409', 'https://openalex.org/W2415369996', 'https://openalex.org/W2365805995', 'https://openalex.org/W2348383661', 'https://openalex.org/W2170951757', 'https://openalex.org/W2086484049', 'https://openalex.org/W2057251756', 'https://openalex.org/W2011955824'], 'abstract_inverted_index': {'Urokinase': [0, 333, 1247, 1408, 2467, 4318], 'plasminogen': [1, 334, 667, 733, 862, 868, 875], 'activator': [2, 335, 668, 734, 869, 876], '(uPA)': [3, 336], 'is': [4, 312, 337, 645, 1248, 1289, 1314, 1790, 1942, 2154, 2171, 2186, 2469, 2626], 'thought': [5, 338], 'to': [6, 62, 164, 173, 186, 223, 236, 246, 320, 339, 395, 497, 506, 519, 556, 569, 579, 653, 1073, 1416, 1422, 1785, 2141, 2156, 2191, 2472, 2632, 2648, 3040, 3064, 3126, 3271, 3365, 3376, 3399, 3447, 3560, 3842, 4041, 4086, 4135, 4173, 4197, 4224, 4381], 'exert': [7, 340], 'its': [8, 23, 37, 87, 341, 356, 370, 420, 1794, 1945, 2425, 3371], 'effects': [9, 342, 2561], 'on': [10, 148, 194, 203, 314, 343, 481, 527, 536, 647, 1793, 1944, 2562, 2574, 3383, 4266, 4357, 4395], 'cell': [11, 24, 126, 206, 344, 357, 459, 539, 883, 1067, 1252, 1482, 1496, 1940, 2024, 2031, 2158, 2280, 2483, 2563, 2575, 2588, 2630, 2711, 3570, 3760, 3905, 4143, 4147, 4194, 4231, 4244, 4289], 'growth,': [12, 345], 'adhesion,': [13, 346], 'and': [14, 20, 33, 86, 102, 139, 153, 169, 197, 255, 272, 326, 347, 353, 366, 419, 435, 472, 486, 502, 530, 588, 605, 659, 768, 771, 873, 982, 1304, 1322, 1346, 1360, 1384, 1410, 1484, 1498, 1854, 2033, 2090, 2163, 2166, 2278, 2282, 2434, 2565, 2593, 2621, 2723, 2755, 2790, 2803, 2814, 2859, 2885, 2898, 2908, 2929, 2949, 3119, 3134, 3173, 3190, 3209, 3216, 3218, 3230, 3240, 3315, 3440, 3462, 3473, 3483, 3528, 3547, 3557, 3577, 3687, 3696, 3704, 3721, 3781, 3788, 3881, 3907, 3963, 4002, 4039, 4067, 4089, 4204, 4272, 4329, 4341, 4375], 'migration': [15, 127, 348, 460, 884, 1483, 1941, 2032, 2564, 2576, 2631, 4195, 4245, 4290], 'by': [16, 270, 349, 603, 865, 1138, 1250, 2014, 2235, 2713, 2848, 2865, 3019, 3024, 3027, 3166, 3254, 3298, 3331, 3380, 3460, 3661, 3674, 3702, 3888, 3914, 4355, 4372], 'mechanisms': [17, 350], 'involving': [18, 351], 'proteolysis': [19, 352, 1506], 'interaction': [21, 187, 227, 354, 520, 560, 1087, 1480, 1948, 2143, 2650], 'with': [22, 58, 66, 72, 117, 128, 151, 182, 188, 228, 281, 331, 355, 391, 399, 405, 450, 461, 484, 515, 521, 561, 614, 664, 685, 692, 704, 1064, 1075, 1088, 1418, 1949, 1955, 2088, 2276, 2651, 2696, 2772, 2787, 2891, 2904, 2912, 2919, 2933, 3012, 3029, 3149, 3342, 3386, 3397, 3537, 3572, 3767, 3866, 4035, 4080, 4152, 4157, 4212, 4238, 4269, 4284, 4324, 4346, 4364, 4388], 'surface': [25, 207, 323, 358, 540, 656, 1068], 'receptor': [26, 359, 731, 1961, 1968, 2196], '(uPAR).': [27, 360], 'The': [28, 52, 122, 177, 361, 385, 455, 510, 1129, 1310, 2026, 2782, 3046, 3058, 3144, 3161, 3246, 3256, 3282, 3358, 3442, 3452, 3476, 3521, 3669, 3759, 3791, 3830, 3859, 3975, 4028, 4049, 4241], 'functional': [29, 362], 'properties': [30, 363], 'of': [31, 36, 68, 75, 83, 131, 179, 217, 221, 238, 243, 262, 288, 303, 317, 324, 329, 364, 369, 401, 408, 416, 464, 512, 550, 554, 571, 576, 595, 621, 636, 650, 657, 662, 672, 676, 680, 694, 706, 719, 861, 1079, 1106, 1291, 1362, 1487, 1490, 1505, 1783, 1842, 2028, 2074, 2147, 2174, 2182, 2264, 2477, 2568, 2572, 2583, 2608, 2616, 2628, 2643, 2701, 2710, 2775, 2809, 2863, 2921, 2935, 3022, 3060, 3136, 3204, 3214, 3248, 3304, 3361, 3454, 3479, 3524, 3539, 3677, 3921, 4099, 4139, 4181, 4188, 4243, 4276, 4327, 4332, 4349], 'uPA': [32, 54, 120, 330, 365, 387, 453, 663, 673, 677, 681, 724, 730, 878, 1784, 2015, 2029, 2573, 2584, 2596, 2617, 2820, 2864, 2911, 3061, 3137, 3215, 3482, 3485], 'the': [34, 80, 119, 136, 166, 174, 195, 214, 239, 282, 301, 315, 318, 321, 327, 367, 413, 452, 469, 499, 507, 528, 547, 572, 615, 634, 648, 651, 654, 660, 858, 1077, 1135, 1350, 1411, 1425, 1485, 1495, 1781, 1843, 1857, 2072, 2075, 2083, 2148, 2157, 2428, 2431, 2473, 2555, 2559, 2566, 2569, 2581, 2600, 2605, 2622, 2640, 2690, 2698, 2708, 2810, 2876, 2894, 3013, 3140, 3193, 3202, 3228, 3233, 3249, 3288, 3299, 3316, 3334, 3387, 3392, 3401, 3434, 3470, 3480, 3490, 3533, 3675, 3693, 3697, 3825, 3843, 3849, 3928, 4014, 4031, 4076, 4092, 4137, 4158, 4175, 4178, 4182, 4186, 4189, 4205, 4227, 4257, 4292, 4342, 4389], 'significance': [35, 368, 1078], 'various': [38, 371], 'domains': [39, 372, 2442, 2571, 2586, 2607], 'for': [40, 300, 373, 633, 699, 711, 2189, 2926, 3192, 3267, 3370, 3544, 3681, 3856, 3878, 3969, 4008, 4022, 4169, 4220, 4250, 4335], 'chemotactic': [41, 106, 374, 439, 1108, 1788, 2177], 'activity': [42, 375, 1265, 1796, 2620], 'were': [43, 91, 111, 141, 234, 376, 424, 444, 474, 567, 2100, 2725, 2796, 2845, 2945, 3225, 3313, 3487, 3530, 3553, 3700, 3717, 3751, 3762, 3851, 3862, 3884, 3933, 3938, 4033, 4078, 4218, 4295, 4322, 4392], 'analyzed': [44, 377, 3701, 4296], 'using': [45, 159, 378, 492, 3032, 3115, 3180, 3430, 3465, 3489, 3707, 3839, 3898, 4091, 4106, 4297], 'human': [46, 379, 735, 740, 2776, 2818, 3799], 'airway': [47, 380, 736, 3712], 'smooth': [48, 381, 737, 3713], 'muscle': [49, 382, 738, 3714], 'cells': [50, 251, 266, 279, 325, 383, 584, 599, 612, 658, 739, 743, 3715, 3748, 3838, 3850, 3861, 3892, 4176, 4271, 4277], '(hAWSMC).': [51, 384], 'wild-type': [53, 386, 2913], '(r-uPAwt),': [55, 388, 2915], 'inactive': [56, 389, 690, 702, 2917, 2931], 'urokinase': [57, 65, 84, 390, 398, 417, 684, 691, 703, 2702, 2744, 2873, 2918, 2932, 3011, 3036, 3157, 3406, 3448, 3456, 3471, 3492, 3535], 'single': [59, 230, 296, 392, 563, 629, 1256, 1318], 'mutation': [60, 67, 393, 400], '(His204': [61, 394], 'Gln)': [63, 396], '(r-uPAH/Q),': [64, 397, 2928], 'His204to': [69, 402], 'Gln': [70, 403, 700, 2927, 3545], 'together': [71, 404], 'a': [73, 154, 160, 170, 189, 198, 229, 258, 295, 406, 487, 493, 503, 522, 531, 562, 591, 628, 1107, 1255, 1296, 1300, 1305, 1317, 1488, 1787, 1835, 2176, 2194, 2236, 2614, 2633, 2800, 3154, 3168, 3181, 3185, 3237, 3263, 3268, 3343, 3918, 4081, 4107, 4145, 4164, 4281], 'deletion': [74, 407, 725, 2934], 'growth': [76, 409, 669, 770, 1139, 1306, 1845, 1848, 1851, 2432, 2623, 2691], 'factor-like': [77, 410, 670, 1307, 2433, 2624, 2692, 2942], 'domain': [78, 82, 89, 124, 216, 411, 415, 422, 457, 549, 671, 675, 679, 729, 1298, 1302, 1308, 2625, 2700, 2773, 3015, 3038, 3049, 4191], '(r-uPAH/Q-GFD),': [79, 412], 'catalytic': [81, 414, 3014, 3037, 3472], '(r-uPALMW),': [85, 418], 'kringle': [88, 123, 215, 421, 456, 548, 674, 728, 1301, 2435, 2474, 2699, 2877, 2895, 3048, 3393, 3474], '(r-KD)': [90, 423, 3050], 'expressed': [92, 285, 425, 618, 864, 2946, 3887, 4273, 4313], 'inEscherichia': [93, 426, 2947], 'coli.': [94, 427], 'We': [95, 428], 'demonstrate': [96, 429], 'that': [97, 290, 309, 430, 623, 642, 1259, 1780, 1938, 2009, 2136, 2230, 2613, 2688, 4278], 'glycosylated': [98, 431, 2880, 3481, 3525], 'uPA,': [99, 432, 720, 1076, 2421, 2423, 2881, 3526], 'r-uPAwt,': [100, 433, 2882, 3527, 4200], 'r-uPAH/Q,': [101, 434, 2883], 'r-uPAH/Q-GFD': [103, 222, 256, 271, 436, 555, 589, 604, 3576], 'elicited': [104, 437], 'similar': [105, 235, 260, 438, 568, 593, 1419, 2634, 3573], 'effects.': [107, 440], 'Half-maximal': [108, 441], 'chemotaxis': [109, 145, 311, 442, 478, 644, 1082, 1136, 2018, 2283, 2417, 2712], '(EC50)': [110, 443], 'apparent': [112, 445], 'at': [113, 446, 1358, 3666, 3684, 3785, 3965, 3972, 4011, 4018, 4025, 4056, 4253, 4338], 'approximately': [114, 447], '2': [115, 448, 3990], 'nm': [116, 449], 'all': [118, 451], 'variants.': [121, 454], 'induced': [125, 458], 'an': [129, 149, 204, 226, 462, 482, 537, 559, 2267, 3128, 3813, 3899], 'EC50': [130, 463], 'about': [132, 465], '6': [133, 466, 1400, 3322], 'nm,': [134, 467], 'whereas': [135, 468], 'denaturated': [137, 470, 2905], 'r-KD': [138, 471, 3305, 3362, 3445, 3552, 3654, 3671, 3695, 3699, 4203], 'r-uPALMW': [140, 473, 3016, 3529, 3578], 'without': [142, 475, 3138], 'effect.': [143, 476], 'R-uPAwt-induced': [144, 477], 'was': [146, 184, 210, 298, 479, 517, 543, 631, 2036, 2068, 2105, 2646, 2734, 2750, 2758, 2778, 3017, 3051, 3113, 3124, 3147, 3164, 3178, 3252, 3296, 3306, 3328, 3378, 3395, 3458, 3582, 3659, 3672, 3805, 3822, 3977, 4016, 4053, 4101, 4155, 4196, 4233, 4246, 4306, 4344, 4352], 'dependent': [147, 313, 480, 646, 1085, 1791, 1943], 'association': [150, 328, 483, 661], 'uPAR': [152, 162, 283, 485, 495, 616, 1080, 1111, 2099, 2153, 2190, 2237, 2277, 2652, 2777, 3568, 3901, 4140], 'uPA-kringle': [155, 175, 319, 488, 508, 652], 'domain-binding': [156, 489], 'site,': [157, 490], 'determined': [158, 491, 3488, 4102], 'monoclonal': [161, 171, 494, 504, 744, 2765, 2807, 3033, 3388, 3466], 'antibody': [163, 172, 496, 505, 745, 2766, 3034, 3389], 'prevent': [165, 498], 'uPA-uPAR': [167, 500], 'interaction,': [168, 501], 'domain.': [176, 509], 'binding': [178, 192, 201, 220, 245, 263, 302, 316, 511, 525, 534, 553, 578, 596, 635, 649, 1114, 2263, 2642], 'iodinated': [180, 513, 4323, 4350, 4390], 'r-uPAwt': [181, 244, 254, 514, 577, 587, 3023, 3272], 'hAWSMC': [183, 224, 516, 557, 4100, 4146], 'due': [185, 518], 'high': [190, 523, 1065, 1420, 2741, 2858], 'affinity': [191, 200, 241, 524, 533, 574, 1066, 1421, 3030, 3368, 3381, 3428, 3900], 'site': [193, 202, 231, 242, 297, 526, 535, 564, 575, 630, 3130], 'uPAR,': [196, 529, 1950, 2697], 'lower': [199, 532, 4228], 'unidentified': [205, 538], 'target,': [208, 541], 'which': [209, 542, 1141, 1502, 2077, 2272, 2437, 2481, 2645, 2694, 2770], 'mediated': [211, 544], 'exclusively': [212, 545], 'through': [213, 546], 'urokinase.': [218, 551, 2609], 'Specific': [219, 552], 'involved': [225, 558, 762, 2706], 'whose': [232, 565], 'characteristics': [233, 566], 'those': [237, 570], 'low': [240, 573, 715, 1352, 1956, 1965, 2860, 3008], 'hAWSMC.': [247, 580], 'uPAR-deficient': [248, 581], 'HEK': [249, 277, 582, 610, 3749, 3836, 3890, 3911, 4230], '293': [250, 278, 583, 611, 3750, 3837, 3891, 3912], 'specifically': [252, 585, 3566, 3893], 'bound': [253, 291, 586, 624, 3894], 'via': [257, 590, 1062, 1424, 2160, 2653], 'single,': [259, 592], 'type': [261, 594, 687], 'site.': [264, 597, 3245], 'These': [265, 598], 'migrated': [267, 600], 'when': [268, 601, 2086, 2095], 'stimulated': [269, 602], 'uPAwt,': [273, 606, 2907, 3896], 'but': [274, 607], 'not': [275, 608, 2172, 2889, 2902], 'r-uPALMW.': [276, 609], 'transfected': [280, 613, 3834, 3860, 3913], 'cDNA': [284, 617, 3062], 'two': [286, 619, 859, 2804], 'classes': [287, 620], 'sites': [289, 622], 'r-uPAwt;': [292, 625], 'however,': [293, 626], 'only': [294, 627, 1792], 'responsible': [299, 632], 'r-uPAH/Q-GFD.': [304, 637, 2909], 'Together,': [305, 638], 'these': [306, 639, 2006, 2133, 2553, 3889], 'findings': [307, 640], 'indicate': [308, 641, 1779, 2008], 'uPA-induced': [310, 643, 1939, 4142, 4193], 'membrane': [322, 655, 2159, 4052], 'uPAR.': [332, 665], 'urokinase-type': [666, 867], 'proteolytic': [678, 1116, 1264, 1297, 1795, 1946, 2619, 3020, 3522], 'recombinant': [682, 2595, 3047, 3455, 3484, 3895], 'single-chain': [683], 'wild': [686], 'structure': [688, 2914, 3247, 3360], 'proteolytically': [689, 701, 2916, 2930, 3554], 'substitution': [693, 705, 2920, 3538], 'His204': [695, 707, 2922, 3540], 'in': [696, 708, 763, 1081, 1134, 2016, 2030, 2039, 2071, 2082, 2098, 2587, 2599, 2707, 2923, 3053, 3262, 3319, 3405, 3426, 3541, 3764, 3864, 3927, 3979, 4030, 4059, 4141, 4149, 4192, 4235, 4256], 'active': [697, 709, 1311, 2924, 3542], 'center': [698, 710, 2925, 3543], 'Gln,': [712], 'lacking': [713, 727, 2618, 2893], 'GFD': [714, 1426, 2654, 3133], 'molecular': [716, 1353, 2742, 2861, 3009], 'weight': [717, 1354, 2743, 3010], 'form': [718, 1355, 2615], 'containing': [721, 2875, 3184, 3321, 3798, 3871, 3947, 3986, 4061], 'mainly': [722, 1363], 'PD': [723, 1364], 'mutant': [726], 'tissue-type': [732, 874], 'embryonic': [741, 3746], 'kidney': [742, 3747], 'phosphate-buffered': [746], 'saline': [747], "Dulbecco's": [748, 2715], 'modified': [749, 2716], "Eagle's": [750, 2717], 'medium': [751, 2718], 'polyacrylamide': [752], 'gel': [753], 'electrophoresis': [754], 'bovine': [755, 2721, 3770, 3869], 'serum': [756, 3870], 'albumin': [757], 'Plasminogen': [758], 'activators': [759, 863], 'are': [760, 1503, 3290, 4261, 4312], 'directly': [761, 2275], 'inflammation,': [764], 'angiogenesis,': [765], 'tissue': [766, 2034, 2150], 'remodeling,': [767], 'tumor': [769], 'invasion': [772], '(for': [773], 'review,': [774], 'see': [775], 'Refs.': [776], '1.Blasi': [777], 'F.': [778, 1119, 1466, 1592, 1594, 1892, 1908, 1918, 2051, 2118, 2198, 2217, 2219, 2240, 2250, 3079], 'Immunol.': [779, 2315], 'Today.': [780, 2316], '1997;': [781, 1096, 1175, 1188, 1646, 1922, 1997, 2058, 2253, 2363, 2386, 2974, 4130], '18:': [782], '415-417Abstract': [783], 'Full': [784, 801, 803, 950, 952, 972, 974, 1004, 1191, 1193, 1282, 1340, 1376, 1447, 1473, 1551, 1553, 1573, 1575, 1649, 1651, 1740, 1742, 1925, 1927, 2320, 2366, 2461, 2542, 2544, 3419, 3643, 3645], 'Text': [785, 802, 804, 951, 953, 973, 975, 1005, 1192, 1194, 1283, 1341, 1377, 1448, 1474, 1552, 1554, 1574, 1576, 1650, 1652, 1741, 1743, 1926, 1928, 2321, 2367, 2462, 2543, 2545, 3420, 3644, 3646], 'PDF': [786, 805, 954, 976, 1006, 1195, 1284, 1342, 1378, 1449, 1475, 1555, 1577, 1653, 1744, 1929, 2322, 2368, 2463, 2546, 3421, 3647], 'PubMed': [787, 806, 826, 901, 925, 955, 977, 1007, 1039, 1057, 1099, 1124, 1196, 1221, 1242, 1285, 1343, 1379, 1450, 1476, 1526, 1556, 1578, 1600, 1654, 1690, 1719, 1745, 1772, 1812, 1829, 1870, 1900, 1930, 1982, 2000, 2061, 2127, 2203, 2225, 2256, 2304, 2323, 2346, 2369, 2409, 2464, 2512, 2547, 2680, 3002, 3086, 3353, 3422, 3516, 3612, 3648, 3742], 'Scopus': [788, 807, 827, 902, 926, 956, 978, 1040, 1058, 1100, 1125, 1197, 1222, 1243, 1380, 1404, 1527, 1557, 1579, 1601, 1655, 1691, 1720, 1746, 1773, 1813, 1830, 1871, 1901, 1931, 1983, 2001, 2062, 2128, 2204, 2226, 2257, 2305, 2324, 2347, 2370, 2410, 2513, 2548, 2681, 3003, 3087, 3109, 3354, 3517, 3613, 3649], '(240)': [789], 'Google': [790, 809, 829, 855, 904, 928, 958, 980, 1008, 1042, 1060, 1102, 1127, 1199, 1224, 1245, 1286, 1344, 1382, 1406, 1451, 1477, 1529, 1559, 1581, 1603, 1657, 1677, 1693, 1722, 1748, 1775, 1815, 1832, 1873, 1903, 1933, 1985, 2003, 2064, 2130, 2206, 2228, 2259, 2307, 2326, 2349, 2372, 2389, 2412, 2465, 2515, 2550, 2683, 3005, 3089, 3111, 3356, 3423, 3519, 3615, 3651, 3743], 'Scholar,': [791, 810, 830, 905, 929, 959, 1009, 1043, 1178, 1200, 1225, 1452, 1530, 1560, 1582, 1604, 1658, 1678, 1694, 1723, 1749, 1816, 1874, 1904, 1986, 2207, 2308, 2327, 2350, 2373, 2390, 3090, 3616], '2.Carmeliet': [792], 'P.': [793, 1021, 1184, 1642, 2043, 2108, 2450, 2504, 2851, 3073, 3507, 3604], 'Collen': [794, 2054, 2119], 'D.': [795, 890, 997, 1440, 1630, 2055, 2120, 2521, 2525, 3094, 3622, 3626], 'Kidney': [796], 'Int.': [797, 849], '1998;': [798, 947, 969, 1036, 1218, 1548, 1570, 1674, 1687, 1737, 2124, 2406, 2509, 3609], '53:': [799], '1519-1549Abstract': [800], '(88)': [808], '3.Tkachuk': [811], 'V.': [812, 814, 1013, 1031, 1156, 1172, 1698, 2444, 2955, 2971, 3499, 4111, 4127], 'Stepanova': [813, 2668, 2990], 'Little': [815, 1167, 2966, 4122], 'P.J.': [816, 1168, 1806, 2967, 4123], 'Bobik': [817, 1157, 2956, 4112], 'A.': [818, 933, 1158, 1162, 1207, 1391, 1393, 1462, 1534, 1804, 2448, 2957, 2961, 3069, 3408, 4113, 4117], 'Clin.': [819, 1237], 'Exp.': [820, 919, 1520, 1714, 2404], 'Pharm.': [821], 'Physiol.': [822, 3738], '1996;': [823, 1597, 1979, 2222, 2317, 2343, 2539, 3640], '23:': [824, 1374], '759-765Crossref': [825], '(57)': [828], '4.Mohanam': [831], 'S.': [832, 892, 1166, 1588, 1910, 1916, 2114, 2213, 2337, 2527, 2850, 2965, 3077, 3501, 3628, 4121], 'Go': [833], 'Y.': [834, 1823, 1888, 2246, 2329, 2517, 3618], 'Sawaya': [835], 'R.': [836, 913, 1160, 1209, 1514, 1610, 2053, 2662, 2959, 2984, 4115], 'Venkaiah': [837], 'B.': [838], 'Mohan': [839], 'P.M.': [840, 1894], 'Kouraklis': [841], 'G.P.': [842], 'Gokaslan': [843], 'Z.L.': [844], 'Lagos': [845], 'G.K.': [846], 'Rao': [847], 'J.S.': [848], 'J.': [850, 895, 944, 966, 995, 998, 1051, 1185, 1217, 1236, 1276, 1334, 1397, 1438, 1441, 1467, 1545, 1567, 1596, 1643, 1685, 1696, 1702, 1713, 1734, 1766, 1864, 1896, 1906, 1919, 2049, 2121, 2221, 2252, 2298, 2362, 2403, 2452, 2455, 2523, 2535, 2536, 2672, 2994, 3349, 3413, 3624, 3636, 3637, 3737], 'Oncol.': [851], '1999;': [852, 1054, 1121, 1769, 2200, 2677, 2999, 3513], '14:': [853], '169-174PubMed': [854], 'Scholar).': [856, 1128, 1246, 1287, 1407, 1478, 1776, 1934, 2004, 2131, 2413, 2466, 2551, 2684, 3006, 3357, 3520, 3652, 3744, 4133], 'Of': [857], 'types': [860], 'tissues,': [866], '(uPA1': [870], 'or': [871, 1115, 1262, 1837, 1840, 1963, 2139, 2261, 2424, 4163, 4202, 4211], 'urokinase)': [872], '(tPA),': [877], 'rather': [879], 'than': [880], 'tPA': [881, 2756], 'promotes': [882], '(5.Busso': [885], 'N.': [886, 1025, 1590, 1822, 2215, 2244], 'Masur': [887], 'S.K.': [888], 'Lazega': [889], 'Waxman': [891], 'Ossowski': [893, 1049], 'L.': [894, 1050, 1275, 1333, 1876, 1878, 2045, 2110, 2446], 'Cell': [896, 920, 1052, 1094, 1521, 1767, 1865, 2122, 3756], 'Biol.': [897, 945, 967, 999, 1053, 1095, 1186, 1277, 1335, 1442, 1468, 1546, 1568, 1644, 1735, 1768, 1866, 1920, 1978, 2123, 2300, 2456, 2537, 3414, 3638], '1994;': [898, 922, 1239, 1523], '126:': [899], '259-270Crossref': [900], '(260)': [903], '6.Anichini': [906], 'E.': [907, 1170, 1454, 1508, 1880, 2248, 2969, 3054, 3292, 3503, 3922, 4125], 'Fibbi': [908, 1509], 'G.': [909, 1464, 1510, 1632, 1660, 1884, 3071, 3075], 'Pucci': [910, 1511, 1661], 'M.': [911, 915, 918, 991, 1017, 1434, 1512, 1516, 1519, 1584, 1586, 1608, 1620, 1622, 1662, 1669, 1757, 1882, 2112, 2209, 2211, 2242, 2331, 2492, 2533, 3096, 3592, 3634], 'Caldini': [912, 1513], 'Chevanne': [914, 1515], 'Del': [916, 1517, 1667], 'Rosso': [917, 1518, 1668], 'Res.': [921, 1372, 1522, 1808, 2057, 2385, 2507, 2676, 2998, 3082, 3607], '213:': [923, 1524], '438-448Crossref': [924, 1525], '(56)': [927, 1528], '7.Dumler': [930, 1531], 'I.': [931, 993, 1164, 1182, 1436, 1532, 1612, 1708, 2377, 2963, 4119], 'Weis': [932, 1533], 'Mayboroda': [934, 1535], 'O.A.': [935, 1536], 'Maasch': [936, 1537], 'C.': [937, 1538, 1606, 1700], 'Jerke': [938, 1539], 'U.': [939, 1033, 1202, 1540, 1664], 'Haller': [940, 1541], 'H.': [941, 1019, 1027, 1542, 1618, 1638, 1712, 1725, 1890, 1914, 2494, 3594], 'Gulba': [942, 1543], 'D.C.': [943, 1544], 'Chem.': [946, 968, 1000, 1187, 1278, 1336, 1443, 1469, 1547, 1569, 1645, 1736, 1921, 2457, 2538, 3415, 3639], '273:': [948, 970, 1549, 1571, 1738, 2344], '315-321Abstract': [949, 1550], '(163)': [957, 1558], '8.Nguyen': [960, 1561], 'D.H.D.': [961, 1562], 'Hussaini': [962, 1563], 'I.M.': [963, 1564], 'Gonias': [964, 1565, 1764], 'S.L.': [965, 1566, 1765], '8502-8507Abstract': [971, 1572], '(192)': [979, 1580], 'Scholar)': [981, 1061, 2260, 2844, 3112, 3424], 'proliferation': [983, 2486], '(9.Rabbani': [984, 1427], 'S.A.': [985, 1428, 2658, 2980], 'Mazar': [986, 1429, 2447], 'A.P.': [987, 1389, 1430], 'Bernier': [988, 1431], 'S.M.': [989, 1432, 2394], 'Haq': [990, 1433], 'Bolivar': [992, 1435], 'Henkin': [994, 1396, 1437, 2451], 'Goltzman': [996, 1439], '1992;': [1001, 1399, 1444, 1826, 1897, 2458], '267:': [1002, 1445, 2459], '14151-14156Abstract': [1003, 1446], '10.Fischer': [1010], 'K.': [1011, 1048, 1273, 1331, 1640, 2454, 3410], 'Lutz': [1012], 'Wilhelm': [1014], 'O.': [1015, 1624, 1634, 1706, 1861], 'Schmitt': [1016], 'Graeff': [1018], 'Heiss': [1020], 'Nishiguchi': [1022], 'T.': [1023, 1029, 1731, 3412], 'Harbeck': [1024], 'Kessler': [1026], 'Luther': [1028], 'Magdolen': [1030], 'Reuning': [1032], 'FEBS': [1034, 1173, 2972, 4128], 'Lett.': [1035, 1174, 2973, 4129], '438:': [1037], '101-105Crossref': [1038], '(61)': [1041], '11.Aguirre': [1044], 'Ghiso': [1045], 'J.A.': [1046, 1213, 2289], 'Kovalski': [1047], '147:': [1055], '89-103Crossref': [1056], '(466)': [1059], 'interactions': [1063, 1954], 'receptors': [1069], '(uPAR/CD87).': [1070], 'In': [1071, 2093], 'addition': [1072, 3676], 'interacting': [1074], 'also': [1083, 1132, 2704], 'appears': [1084], 'upon': [1086, 2023], 'integrins': [1089], '(12.Chapman': [1090], 'H.A.': [1091, 2341], 'Curr.': [1092], 'Opin.': [1093], '9:': [1097], '714-724Crossref': [1098], '(424)': [1101], 'Scholar),': [1103, 1345, 1383, 1833, 2065, 2229], 'and/or': [1104, 2485], 'exposure': [1105], 'epitope': [1109], 'within': [1110, 1494], 'following': [1112, 2262], 'ligand': [1113], 'cleavage': [1117, 1319, 3021], '(13.Blasi': [1118, 2197], 'APMIS.': [1120, 2199], '107:': [1122, 2201], '96-101Crossref': [1123, 2202], '(84)': [1126, 2205], 'urokinase/uPAR': [1130], 'system': [1131], 'participates': [1133], 'initiated': [1137], 'factors': [1140], 'activate': [1142], 'tyrosine': [1143], 'kinase': [1144], 'receptors,': [1145], 'as': [1146, 1148, 1153, 1254, 1951, 1953, 2193, 2439, 2602, 2604, 2636, 2951, 3056, 3276, 3309, 3495, 3549, 3551, 3584, 3723, 3935, 4103, 4263, 4274, 4314], 'well': [1147, 1952, 2603, 3550], 'several': [1149], 'chemoattractant': [1150], 'molecules': [1151], 'such': [1152], 'formylmethionylleucylphenylalanine': [1154], '(14.Stepanova': [1155, 2954, 4110], 'Bibilashvily': [1159, 2661, 2958, 2983, 4114], 'Belogurov': [1161, 2960, 4116], 'Rybalkin': [1163, 2962, 4118], 'Domogatsky': [1165, 2827, 2964, 4120], 'Goncharova': [1169, 2968, 4124], 'Tkachuk': [1171, 2670, 2970, 2992, 3508, 4126], '414:': [1176, 2975, 4131], '417-474Google': [1177, 2976, 4132], '15.Herbert': [1179], 'J.-M.': [1180], 'Lamarche': [1181], 'Carmeliet': [1183], '272:': [1189, 1647, 1923], '23585-23591Abstract': [1190], '(68)': [1198], '16.Cavallaro': [1201], 'Wu': [1203], 'Z.': [1204], 'Di': [1205], 'Palo': [1206], 'Montesano': [1208], 'Pepper': [1210], 'M.S.': [1211, 2531, 3632], 'Maier': [1212], 'Soria': [1214], 'M.R.': [1215, 1227, 2285], 'FASEB': [1216], '12:': [1219], '1027-1034Crossref': [1220], '(21)': [1223], '17.Gyetko': [1226], 'Todd': [1228, 2290, 2311, 2355, 2378], '3': [1229, 2291, 2312, 2356, 2379, 2768, 3970, 4251], 'rd,': [1230, 2292, 2313, 2357, 2380], 'R.F.': [1231, 2293, 2314, 2358, 2381], 'Wilkinson': [1232], 'C.C.': [1233], 'Sitrin': [1234, 2286], 'R.G.': [1235, 2287], 'Invest.': [1238], '93:': [1240], '1380-1387Crossref': [1241], '(289)': [1244], 'secreted': [1249], 'many': [1251], 'types,': [1253], 'chain': [1257], 'polypeptide': [1258, 3269, 3394], 'possesses': [1260], 'little': [1261], 'no': [1263], '(18.Petersen': [1266, 1324], 'L.C.': [1267, 1325], 'Lund': [1268, 1326, 2395], 'L.R.': [1269, 1327, 2396, 3731], 'Nielsen': [1270, 1328], 'L.S.': [1271, 1329], 'Dano': [1272, 1330], 'Skriver': [1274, 1332], '1988;': [1279, 1337], '263:': [1280, 1338], '11189-11195Abstract': [1281, 1339], 'It': [1288, 2638], 'composed': [1290], 'three': [1292], 'structurally': [1293], 'independent': [1294, 1504], 'domains,': [1295, 2436], '(PD),': [1299], '(KD),': [1303], '(GFD).': [1309], 'serine': [1312], 'protease': [1313], 'generated': [1315], 'from': [1316, 1856, 2727, 2736, 2746, 2751, 2759, 2779, 2797, 3287, 3569, 3719, 3752, 3794, 3820, 3904, 4379], 'between': [1320, 3132, 3171, 3207, 3227, 4288], 'Lys158': [1321], 'Ile159': [1323], 'further': [1347], 'plasminolysis': [1348], 'generates': [1349], 'two-chain': [1351], 'uPALMW,': [1356], 'commencing': [1357], 'Lys136': [1359], 'consisting': [1361], '(19.Barlow': [1365], 'G.H.': [1366], 'Francis': [1367], 'C.W.': [1368], 'Marder': [1369], 'V.J.': [1370], 'Thromb.': [1371, 1976, 1995], '1981;': [1373], '541-547Abstract': [1375], '(35)': [1381], 'amino-terminal': [1385], 'fragment': [1386, 2238, 3155, 3183, 3213, 3793, 3819, 3920], '(ATF)': [1387], '(20.Mazar': [1388], 'Buko': [1390], 'Petros': [1392], 'Barnathan': [1394, 1973], 'E.S.': [1395, 1974], 'Fibrinolysis.': [1398], 'Suppl.': [1401], '1:': [1402], '49-55Crossref': [1403], '(30)': [1405], 'PA': [1409], 'ATF': [1412, 2429], 'have': [1413, 1936, 2591], 'been': [1414], 'shown': [1415], 'bind': [1417], 'uPAR/CD87': [1423], '21.Appella': [1453], 'Robinson': [1455], 'E.A.': [1456], 'Ullrich': [1457], 'S.J.': [1458], 'Stopelli': [1459], 'M.P.': [1460], 'Corti': [1461], 'Cassani': [1463], 'Blasi': [1465, 1591, 1891, 2216, 2249, 3078], '1987;': [1470], '262:': [1471], '4437-4440Abstract': [1472], 'This': [1479, 3176, 3199, 3581], 'induces': [1481], 'activation': [1486], 'number': [1489, 3803], 'signal': [1491, 2010], 'transduction': [1492, 2011], 'pathways': [1493, 2012], 'cytoplasm': [1497], 'transcriptional': [1499], 'apparatus;': [1500], 'events': [1501], '(6.Anichini': [1507], '22.Resnati': [1583, 2208], 'Guttinger': [1585, 2210], 'Valcamonica': [1587, 2212], 'Sidenius': [1589, 2214, 2243], 'Fazioli': [1593, 2218], 'EMBO': [1595, 1895, 2220, 2251], '15:': [1598, 2223], '1572-1582Crossref': [1599, 2224], '(303)': [1602, 2227], '23.Sillaber': [1605], 'Baghestanian': [1607], 'Hofbauer': [1609], 'Virgolini': [1611], 'Bankl': [1613], 'H.C.': [1614], 'Füreder': [1615], 'W.': [1616, 1710, 1798, 1886, 2375], 'Agis': [1617], 'Willheim': [1619], 'Leimer': [1621], 'Scheiner': [1623], 'Binder': [1625], 'B.R.': [1626], 'Kiener': [1627], 'H.P.': [1628], 'Bevec': [1629], 'Fritsch': [1631], 'Majdic': [1633, 1705], 'Kress': [1635], 'H.G.': [1636], 'Gadner': [1637], 'Lechner': [1639], 'Valent': [1641], '7824-7832Abstract': [1648], '(74)': [1656], '24.Fibbi': [1659], 'Serni': [1663], 'Cerinic': [1665], 'M.M.': [1666, 2354, 2667, 2989], 'Proc.': [1670], 'Assoc.': [1671], 'Am.': [1672, 3736], 'Physicians.': [1673], '110:': [1675, 1868], '340-350PubMed': [1676], '25.MacDonald': [1679], 'T.J.': [1680, 2297, 3505], 'DeClerck': [1681], 'Y.A.': [1682], 'Laug': [1683], 'W.E.': [1684, 3092], 'Neurooncol.': [1686], '40:': [1688], '215-226Crossref': [1689], '(38)': [1692], '26.Bohuslav': [1695], 'Hoρejsi': [1697], 'Hansmann': [1699], 'Stockl': [1701], 'Weidle': [1703], 'U.H.': [1704], 'Bartke': [1707], 'Knapp': [1709], 'Stockinger': [1711], 'Med.': [1715, 2405], '1995;': [1716, 1809, 2301], '181:': [1717], '1381-1390Crossref': [1718], '(355)': [1721], '27.Tang': [1724], 'Kerins': [1726], 'D.M.': [1727], 'Hao': [1728], 'Q.': [1729], 'Inagami': [1730], 'Vaughan': [1732], 'D.E.': [1733], '18268-18272Abstract': [1739], '(152)': [1747], '28.Nguyen': [1750], 'D.H.': [1751], 'Catling': [1752], 'A.D.': [1753], 'Webb': [1754], 'D.J.': [1755], 'Sankovic': [1756], 'Walker': [1758], 'L.A.': [1759], 'Somlyo': [1760], 'A.V.': [1761], 'Weber': [1762], 'M.J.': [1763, 1988], '146:': [1770], '149-164Crossref': [1771], '(299)': [1774], 'Several': [1777], 'studies': [1778, 2007, 4387], 'ability': [1782], 'initiate': [1786], 'response': [1789], '(29.Wang': [1797], 'Chen': [1799], 'H.J.': [1800], 'Gieddi': [1801], 'K.N.': [1802], 'Schwartz': [1803], 'Cannon': [1805], 'Circ.': [1807, 2056], '77:': [1810], '1095-1106Crossref': [1811], '(20)': [1814], '30.Jackson': [1817], 'C.L.': [1818], 'Reidy': [1819], 'M.A.': [1820], 'Ann.': [1821], 'Acad.': [1824], 'Sci.': [1825], '667:': [1827], '141-150Crossref': [1828], '(81)': [1831], 'implicating': [1834], 'direct': [1836], 'plasmin-mediated': [1838], 'activation,': [1839], 'release': [1841], 'mitogenic': [1844], 'factors-basic': [1846], 'fibroblast': [1847], 'factor,': [1849, 1853], 'hepatocyte': [1850], 'factor/scatter': [1852], 'VEGF−': [1855], 'extracellular': [1858], 'matrix': [1859], '(31.Saksela': [1860], 'Rifkin': [1862], 'D.B.': [1863], '1990;': [1867], '767-775Crossref': [1869], '(433)': [1872], '32.Naldini': [1875], 'Tamagnone': [1877], 'Vigna': [1879], 'Sachs': [1881], 'Hartmann': [1883], 'Birchmaier': [1885], 'Daikuhara': [1887], 'Tsubouchi': [1889], 'Comoglio': [1893], '11:': [1898], '4825-4833Crossref': [1899], '(523)': [1902], '33.Plouët': [1905], 'Moro': [1907], 'Bertagnolli': [1909], 'Coldeboeuf': [1911], 'N': [1912], 'Mazarguil': [1913], 'Clamens': [1915], 'Bayard': [1917], '13390-13396Abstract': [1924], '(212)': [1932], 'Others': [1935], 'demonstrated': [1937, 2038], 'activity,': [1947], 'density': [1957, 1966], 'lipoprotein': [1958, 1967], 'receptor-related': [1959], 'protein/α2-macroglobulin': [1960], '(LRP/α2-MR)': [1962], 'very': [1964], '(34.Okada': [1969], 'S.S.': [1970], 'Grobmeyer': [1971], 'S.R.': [1972], 'Arterioscler.': [1975], 'Vasc.': [1977], '16:': [1980, 2254], '1269-1276Crossref': [1981], '(90)': [1984], '35.Wijnberg': [1987], 'Quax': [1989], 'P.H.': [1990], 'Nieuwenbroek': [1991], 'N.M.': [1992], 'Verheijen': [1993], 'J.H.': [1994], 'Haemost.': [1996], '78:': [1998], '880-886Crossref': [1999], '(60)': [2002], 'Together': [2005, 2132], 'utilized': [2013, 2419], 'initiating': [2017, 2175], 'exhibit': [2019], 'marked': [2020, 2069], 'diversity': [2021], 'depending': [2022], 'type.': [2025], 'importance': [2027], 'remodeling': [2035], 'recently': [2037], 'knockout': [2040], 'mice': [2041, 2096], '(36.Carmeliet': [2042], 'Moons': [2044, 2109], 'Herbert': [2046, 2115], 'J.M.': [2047, 2116], 'Crawley': [2048], 'Lupu': [2050, 2117], 'Lijnen': [2052], '81:': [2059], '829-839Crossref': [2060], '(191)': [2063], 'where': [2066], 'there': [2067], 'reduction': [2070], 'size': [2073, 2104], 'neointima': [2076, 2103], 'forms': [2078, 2597, 2862, 2874, 3457, 3486, 3536], 'after': [2079, 3243, 4248], 'intra-vessel': [2080], 'injury': [2081], 'uPA-deficient': [2084], 'mice,': [2085], 'compared': [2087, 4283], 'tPA-deficient': [2089], 'normal': [2091], 'animals.': [2092], 'contrast,': [2094], 'deficient': [2097, 2598], 'similarly': [2101], 'injured': [2102], 'unaffected': [2106], '(37.Carmeliet': [2107], 'Dewerchin': [2111], 'Rosenberg': [2113, 2336], '140:': [2125], '233-245Crossref': [2126], '(117)': [2129], 'observations': [2134], 'suggest': [2135], 'mechanisms,': [2137], 'distinct': [2138], 'additional': [2140], 'uPA/uPAR': [2142], 'might': [2144, 2269], 'mediate': [2145], 'processes': [2146], 'uPA-dependent': [2149, 2416, 2560], 'remodeling.': [2151], 'Since': [2152], 'attached': [2155], 'glycosylphosphatidylinositol': [2161], 'anchor': [2162], 'lacks': [2164], 'transmembrane': [2165], 'cytoplasmic': [2167], 'regions,': [2168], 'alone': [2169], 'it': [2170, 2887], 'capable': [2173, 2627], 'signal.': [2178], 'An': [2179, 2853, 2868], 'obligatory': [2180], 'partner': [2181], 'yet': [2183], 'unknown': [2184], 'nature': [2185], 'probably': [2187], 'required': [2188], 'act': [2192], 'signaling': [2195], 'can': [2231, 2273, 2703], 'be': [2232, 2270, 2705, 4198, 4369], 'activated': [2233], 'either': [2234], '(38.Fazioli': [2239], 'Resnati': [2241], 'Higashimoto': [2245], 'Appella': [2247], '7279-7286Crossref': [2255], '(230)': [2258], 'uPA.': [2265, 2637, 2714], 'Such': [2266], 'adaptor': [2268], 'integrins,': [2271], 'interact': [2274, 2890, 2903], 'promote': [2279], 'adhesiveness': [2281], '(39.Gyetko': [2284], 'Fuller': [2288], 'Petty': [2294, 2359, 2382], 'H.R.': [2295, 2310, 2360, 2383], 'Standiford': [2296], 'Leukocyte': [2299], '58:': [2302], '533-538Crossref': [2303], '(92)': [2306], '40.Petty': [2309], '17:': [2318], '209-212Abstract': [2319], '(145)': [2325], '41.Wei': [2328], 'Lukashev': [2330], 'Simon': [2332], 'D.I.': [2333], 'Bodary': [2334], 'S.C.': [2335], 'Doyle': [2338], 'M.V.': [2339], 'Chapman': [2340], 'Science.': [2342], '1551-1555Crossref': [2345], '(697)': [2348], '42.Kindzelskii': [2351], 'A.L.': [2352], 'Eszes': [2353], 'Biophys.': [2361, 2506, 3606], '73:': [2364], '1777-1784Abstract': [2365], '(77)': [2371], '43.Xue': [2374], 'Mizukami': [2376], 'Cancer': [2384], '57:': [2387], '1682-1689PubMed': [2388], '44.May': [2391], 'A.E.': [2392], 'Kanse': [2393], 'Gisler': [2397], 'R.H.': [2398], 'Imhof': [2399], 'B.A.': [2400], 'Preissner': [2401], 'K.T.': [2402], '188:': [2407], '1029-1037Crossref': [2408], '(266)': [2411], 'Most': [2414], 'investigating': [2415], 'has': [2418], 'full-length': [2420], 'DFP-inactivated': [2422], 'ATF.': [2426], 'However,': [2427], 'includes': [2430], 'behave': [2438], 'independently': [2440], 'folded': [2441], '(45.Novokhatny': [2443], 'Medved': [2445], 'Marcotte': [2449], 'Ingham': [2453], '3878-3885Abstract': [2460], 'PA-kringle': [2468], 'highly': [2470], 'homologous': [2471], 'structure-containing': [2475], 'fragments': [2476], 'blood': [2478], 'plasma': [2479], 'proteins,': [2480], 'affect': [2482], 'motility': [2484], '(46.Ji': [2487, 3587], 'W.-R.': [2488, 3588], 'Barrientos': [2489, 3589], 'L.G.': [2490, 3590], 'Llinas': [2491, 3591], 'Gray': [2493, 3593], 'Villarreal': [2495, 3595], 'X.': [2496, 3596], 'DeFord': [2497, 3597], 'M.E.': [2498, 3598], 'Castellino': [2499, 3599], 'F.J.': [2500, 3600], 'Kramer': [2501, 3601], 'R.A.': [2502, 3602, 3727], 'Trail': [2503, 3603], 'Biochem.': [2505, 3348, 3512, 3605], 'Commun.': [2508, 3608], '247:': [2510, 3610], '414-419Crossref': [2511, 3611], '(94)': [2514, 3614], 'Scholar,47.Cao': [2516], 'Ji': [2518, 3619], 'R.W.': [2519, 3620], 'Davidson': [2520, 3621], 'Schaller': [2522, 3623], 'Marti': [2524, 3625], 'Söhndel': [2526, 3627], 'McCance': [2528, 3629], 'S.G.': [2529, 3630], "O'Reilly": [2530, 3631], 'Llinás': [2532, 3633], 'Folkman': [2534, 3635], '271:': [2540, 3641], '29461-29467Abstract': [2541, 3642], '(373)': [2549, 3650], 'Despite': [2552], 'observations,': [2554], 'precise': [2556], 'mechanism': [2557], 'mediating': [2558], 'impact': [2567], 'different': [2570, 2805, 4293], 'remain': [2577], 'unclear.': [2578], 'To': [2579], 'elucidate': [2580], 'role': [2582, 4138, 4187], 'structural': [2585], 'migration,': [2589, 4144], 'we': [2590, 2611, 2686], 'constructed': [2592, 3165], 'produced': [2594], 'GFD,': [2601], 'individual': [2606], 'Recently': [2610], 'reported': [2612], 'inducing': [2629], 'extent': [2635, 4242], 'exhibited': [2639], 'atypical': [2641], 'urokinase,': [2644], 'unrelated': [2647], 'any': [2649, 3437], '(48.Poliakov': [2655], 'A.A.': [2656, 2978], 'Mukhina': [2657, 2979, 3500], 'Traktouev': [2659, 2981], 'D.O.': [2660, 2982], 'Sh': [2663, 2985], 'Gursky': [2664, 2986], 'Y.G.': [2665, 2987], 'Minashkin': [2666, 2988], 'V.V.': [2669, 2826, 2991], 'V.A.': [2671, 2993, 3509], 'Recept.': [2673, 2995], 'Signal': [2674, 2794, 2996, 4096], 'Transduct.': [2675, 2997], '19:': [2678, 3000], '939-951Crossref': [2679, 3001], '(26)': [2682, 3004], 'Here': [2685], 'report': [2687], 'besides': [2689], 'domain,': [2693, 2878, 2896], 'interacts': [2695], 'induction': [2709], '(DMEM),': [2719], 'fetal': [2720, 3769, 3868], 'serum,': [2722, 3771], 'LipofectinTM': [2724], 'purchased': [2726], 'Life': [2728], 'Technologies,': [2729, 3876], 'Inc..': [2730], 'Chromogenic': [2731], 'substrate': [2732, 2792, 3493, 4094], 'S-2444': [2733], 'obtained': [2735], 'Chromogenix,': [2737], 'Mölndal,': [2738], 'Sweden.': [2739], 'Glycosylated': [2740], 'purified': [2745, 2950, 3444], 'urine': [2747], '(glycosylated': [2748], 'uPA)': [2749], 'Medac,': [2752], 'Hamburg,': [2753], 'Germany,': [2754], '(Actilyse)': [2757], 'Roche': [2760], 'Molecular': [2761], 'Biochemicals.': [2762], 'A': [2763, 4301], 'mouse': [2764, 2801, 4165, 4214], 'clone': [2767, 3857], '(R-3-01)': [2769], 'reacts': [2771], 'I': [2774], 'Monozyme,': [2780], 'Denmark.': [2781], 'goat': [2783, 4082], 'anti-mouse': [2784, 4083], 'IgG': [2785, 4084], 'conjugated': [2786, 4085], 'horseradish': [2788, 4087], 'peroxidase': [2789, 4088], 'chemiluminescent': [2791, 4093], '"Super': [2793, 4095], 'Substrate"': [2795], 'Pierce.': [2798], 'Plasminogen,': [2799], 'IgG,': [2802], 'murine': [2806], 'antibodies': [2808, 3467], 'IgG1': [2811], 'subtype': [2812], '(UIG-1': [2813], 'UNG-5)': [2815], 'raised': [2816], 'against': [2817, 3035, 3469, 3690], 'urinary': [2819], '(49.Kratasyuk': [2821], 'G.A.': [2822], 'Jakubov': [2823], 'L.Z.': [2824], 'Sinitsyn': [2825], 'S.P.': [2828], 'Rohklin': [2829], 'O.V.': [2830], 'Koltsova': [2831], 'S.V.': [2832], 'Bynyaeva': [2833], 'N.A.': [2834], 'Fedorova': [2835], 'Z.D.': [2836], 'Samsonov': [2837], 'G.V.': [2838], 'Biopolim.': [2839], 'Kletka.': [2840], '1989;': [2841, 3739], '5:': [2842], '95-101Google': [2843], 'kindly': [2846], 'provided': [2847], 'Dr.': [2849], 'Domogatsky.': [2852], 'anti-uPA': [2854, 2869], 'mAb': [2855, 2870, 3432, 3709, 4071, 4160, 4207], 'UIG-1': [2856], 'detected': [2857, 2872], 'Western': [2866, 3463, 3705], 'blots.': [2867], 'UNG-5': [2871, 2900, 4208], '(specifically,': [2879], 'r-uPAH/Q-GFD,': [2884, 4201], 'r-KD);': [2886], 'does': [2888], 'r-uPALMW,': [2892], 'tPA,': [2897], 'plasminogen.': [2899], 'did': [2901, 3579], 'r-KD,': [2906], 'Recombinant': [2910], 'NH2-terminal': [2936], '1–43': [2937], 'amino': [2938, 3065, 3141, 3158, 3196, 3273, 3284, 3449], 'acids': [2939, 3066, 3159, 3197, 3274, 3285, 3450], 'called': [2940], '"growth': [2941], 'domains"': [2943], '(r-uPAH/Q-GFD)': [2944], 'coli': [2948, 3055, 3293, 3923], 'described': [2952, 3496, 3585, 3725, 4104], 'previously': [2953, 3497, 3586, 3724], 'Scholar,48.Poliakov': [2977], 'Two-chain': [3007], 'prepared': [3018, 4234], 'plasmin,': [3025], 'followed': [3026], 'purification': [3028, 3375], 'chromatography,': [3031], 'coupled': [3039, 3385, 3559], 'CNBr-Sepharose': [3041, 3561], '4B': [3042, 3562], '(Amersham': [3043, 3563, 4360], 'Pharmacia': [3044, 3564, 4361], 'Biotech).': [3045], 'made': [3052], 'follows.': [3057], 'region': [3059, 3189], 'corresponding': [3063], '42–210': [3067], '(50.Riccio': [3068], 'Grimaldi': [3070], 'Verde': [3072], 'Sebastio': [3074], 'Boast': [3076], 'Nucleic': [3080], 'Acids': [3081], '1985;': [3083, 3106], '13:': [3084], '2759-2771Crossref': [3085], '(172)': [3088], '51.Holmes': [3091], 'Pennica': [3093], 'Blaber': [3095], 'Rey': [3097], 'M.W.': [3098], 'Guenzler': [3099], 'W.A.': [3100], 'Steffens': [3101], 'G.J.': [3102], 'Heyneker': [3103], 'H.L.': [3104], 'Bio/Technology.': [3105], '3:': [3107], '923-929Crossref': [3108], '(199)': [3110], 'amplified': [3114], 'primers:': [3116], 'M3,': [3117], '5′-CTGTGATCTAGATAAGTCAAAAACCTGCTATGAGGG-3′,': [3118], 'M7,': [3120], '5′-AGCACTGTGTGGCGCTGATCACCCAGCAAGGGCTG-3′.': [3121], 'Primer': [3122], 'M3': [3123], 'designed': [3125], 'introduce': [3127], 'XbaI': [3129, 3150, 3174, 3229], '(underlined)': [3131], 'KD': [3135], 'changing': [3139], 'acid': [3142, 4374], 'sequence.': [3143], 'PCR': [3145], 'product': [3146], 'digested': [3148], 'andEcoRI': [3151], 'enzymes,': [3152], 'generating': [3153], 'coding': [3156, 3191, 3205, 3266], '42–166.': [3160], 'expression': [3162, 3827], 'vector': [3163, 3289, 3828], 'modifying': [3167], 'pTZ19': [3169], 'plasmid': [3170, 3200, 3265, 3797, 3815, 3832, 3915], 'HindIII': [3172], 'sites.': [3175, 3211], 'modification': [3177], 'done': [3179], 'synthetic': [3182, 3221], 'new': [3186], 'translation': [3187], 'initiation': [3188], 'first': [3194], '5': [3195, 3775], '(MKSTL).': [3198], 'allowed': [3201, 3363], 'cloning': [3203, 3257], 'inserts': [3206], 'theXbaI': [3208], 'BamHI': [3210, 3219, 3231], 'TheXbaI-EcoRI': [3212], 'theEcoRI': [3217, 3244], 'ending': [3220], 'duplex:': [3222], '5′-AATTCACCACCCTGCACCATCACCATCACCATTAATAG-3′;': [3223], '3′-GTGGTGGGACGTGGTAGTGGTAGTGGTAATTATCCTAG-5′': [3224], 'ligated': [3226, 3806], 'sites;': [3232], 'duplex': [3234], 'sequence': [3235], 'contains': [3236], 'hexahistidine': [3238, 3435], 'tag': [3239], 'stop': [3241], 'codon': [3242], 'resulting': [3250, 3300, 3443], 'construct': [3251], 'confirmed': [3253, 3459], 'sequencing.': [3255], 'procedures': [3258], 'outlined': [3259], 'above': [3260], 'resulted': [3261], 'pKR-his6': [3264, 3301], 'identical': [3270], '43–166': [3275], 'shown:MKSTLEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDA-': [3277], 'LQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVKECMVHDCADGK-': [3278], 'KPSSPPEELKFQCGQKTLRP': [3279], 'RF': [3280], 'KIIGGEFTTLHHHHHH.': [3281], 'non-urokinase': [3283], 'acquired': [3286], 'underlined.': [3291], 'strain': [3294], 'JM109': [3295], 'transformed': [3297], 'plasmid.': [3302], 'Purification': [3303, 4348], 'carried': [3307, 3329, 4353, 4393], 'out': [3308, 3330, 4354, 4394], 'follows:': [3310], 'inclusion': [3311], 'bodies': [3312], 'isolated': [3314, 3718], 'proteins': [3317, 4029], 'denatured': [3318, 3694], 'buffer': [3320, 3345, 3944, 3983, 4038], 'm': [3323, 3679], 'guanidine': [3324], 'chloride.': [3325], 'Subsequent': [3326, 3374], 'reconstitution': [3327], 'gradually': [3332], 'removing': [3333], 'denaturing': [3335], 'agents': [3336], 'while': [3337, 3575], 'maintaining': [3338], 'appropriate': [3339], 'redox': [3340], 'conditions': [3341, 4294], 'glutathione-containing': [3344], '(52.Marston': [3346], 'F.A.O.': [3347], '1986;': [3350, 3416], '240:': [3351], '1-12Crossref': [3352], '(752)': [3355], 'primary': [3359], 'us': [3364], 'use': [3366], 'nickel-chelate': [3367], 'chromatography': [3369, 3382, 3429, 4356], 'initial': [3372], 'purification.': [3373], 'homogeneity': [3377, 3453], 'achieved': [3379], 'Sepharose': [3384], 'UNG-5.': [3390, 3710], 'Then': [3391, 3817], 'treated': [3396], 'thrombin,': [3398], 'cleave': [3400], 'peptide': [3402], 'bond': [3403], '(Arg156-Phe157)': [3404], '(53.Ichinose': [3407], 'Fujikawa': [3409], 'Suyama': [3411], '261:': [3417], '3486-3489Abstract': [3418], '(shown': [3425], 'bold);': [3427], 'anti-kringle': [3431, 3708, 4206], 'removed': [3433], 'tag,': [3436], 'uncleaved': [3438], 'peptides': [3439, 4351, 4367, 4391], 'thrombin.': [3441], 'corresponded': [3446], 'Glu43-Arg156.': [3451], 'SDS-PAGE': [3461, 3703], 'blotting': [3464, 3706, 4044], 'directed': [3468], 'domains.': [3475], 'amidolytic': [3477], 'activities': [3478, 3523, 4378], 'chromogenic': [3491], 'S-2444,': [3494], '(54.Stepanova': [3498], 'Köhler': [3502], 'Resink': [3504], 'Erne': [3506], 'Mol.': [3510], 'Cell.': [3511], '195:': [3514], '199-206Crossref': [3515], '(44)': [3518], '∼5000': [3531], 'units/nmol;': [3532], 'other': [3534], '(r-uPAH/Q': [3546], 'r-uPAH/Q-GFD)': [3548], 'inactive.': [3555], 'R-uPAwt': [3556], 'r-uPAH/Q': [3558], 'Biotech)': [3565, 4362], 'precipitated': [3567, 4370], 'lysates': [3571, 3906], 'efficiency,': [3574], 'not.': [3580], 'performed': [3583], '47.Cao': [3617], 'Briefly,': [3653, 4134], '(110': [3655], 'μg,': [3656], '1': [3657, 3682, 3950, 3959, 4003, 4068, 4170, 4221, 4325], 'ml)': [3658], 'reduced': [3660, 3670], 'dithiothreitol': [3662], '(0.5m,': [3663], '15': [3664, 4023], 'min': [3665, 3971, 4010, 4024, 4337], 'room': [3667, 4339], 'temperature).': [3668], 'alkylated': [3673], '0.25': [3678], 'iodoacetamide': [3680], 'h': [3683, 4171, 4222, 4252], '4': [3685, 3973, 4012, 4026, 4057], '°C': [3686, 3787, 4058, 4255], 'then': [3688], 'dialyzed': [3689], 'PBS.': [3691, 4365], 'Both': [3692], 'intact': [3698], 'Human': [3711, 3745], '(hAWSMC)': [3716], 'trachea': [3720], 'characterized': [3722], '(55.Panettieri': [3726], 'Murray': [3728], 'R.K.': [3729], 'DePalo': [3730], 'Yadvish': [3732], 'P.A.': [3733], 'Kotlikoff': [3734], 'M.I.': [3735], '256:': [3740], 'C329-C355Crossref': [3741], 'Cardiology': [3753], 'Research': [3754], 'Center': [3755], 'Collection,': [3757], 'Moscow.': [3758], 'lines': [3761], 'cultured': [3763, 3863], 'DMEM': [3765, 3865, 4150, 4236], 'supplemented': [3766, 4151, 4237], '10%': [3768, 3867, 4042], '10': [3772, 3941, 3953, 3956, 3980, 3996, 3999], 'mm': [3773, 3776, 3942, 3951, 3960, 3981, 3988, 3991], 'HEPES,': [3774], 'glutamine,': [3777], '100': [3778, 3782], 'units/ml': [3779, 3783], 'penicillin,': [3780], 'streptomycin': [3784], '37': [3786, 4254], '5%': [3789], 'CO2.': [3790], 'XbaI-EcoRI': [3792], 'pB': [3795], 'SK-(uPAR)': [3796], 'uPAR-cDNA': [3800], '(GenBank': [3801], 'accession': [3802], 'X51675),': [3804], 'into': [3807, 3824, 3835, 3940, 4177, 4226], 'pUC19': [3808], '(New': [3809], 'England': [3810], 'Biolabs)': [3811], 'producing': [3812], 'intermediate': [3814], 'pUC-uPAR.': [3816], 'theHindIII-EcoRI': [3818], 'pUC-uPAR': [3821], 'inserted': [3823, 3926], 'pcDNA3': [3826], '(Invitrogen).': [3829], 'resultant': [3831], 'pcDNA-uPAR': [3833], 'Lipofectin,': [3840], 'according': [3841], 'manufacturers': [3844], 'protocol.': [3845], 'Two': [3846], 'days': [3847, 3880], 'later': [3848], 'plated': [3852], 'onto': [3853, 4045], '96-well': [3854], 'plates': [3855], 'selection.': [3858], '1.5': [3872], 'mg/ml': [3873], 'G418': [3874], '(Life': [3875], 'Inc.)': [3877], '25': [3879], 'G418-resistant': [3882], 'clones': [3883], 'analyzed.': [3885], 'Recombinant-uPAR': [3886], 'assessed': [3897], 'precipitation': [3902], 'method': [3903], 'immobilized': [3908], 'r-uPAwt.': [3909], 'Cells': [3910, 3937], 'pcDNA3-anti-βGAL': [3916], 'bearing': [3917], '3-kilobase': [3919], 'β-galactosydase': [3924], 'gene': [3925], 'antisense': [3929], 'orientation': [3930], '(HEK-control': [3931], 'cells)': [3932], 'used': [3934], 'controls.': [3936], 'scraped': [3939], 'HEPES': [3943], '(pH': [3945, 3984], '7.2),': [3946], '150': [3948, 3987], 'mmNaCl,': [3949], 'EDTA,': [3952, 3992], 'μg/ml': [3954, 3957, 3997, 4000, 4069], 'leupeptin,': [3955, 3998], 'pepstatin,': [3958, 4001], 'phenylmethylsulfonyl': [3961], 'fluoride,': [3962], 'centrifuged': [3964, 4017], '1500': [3966], '×': [3967, 4020, 4383], 'g': [3968, 4021], '°C.': [3974, 4027], 'pellet': [3976], 'resuspended': [3978], 'Tris-HCl': [3982], '8.0),': [3985], 'NaCl,': [3989], '1%': [3993, 4062, 4239], 'Triton': [3994], 'X-100,': [3995], 'mmphenylmethylsulfonyl': [4004], 'fluoride.': [4005], 'After': [4006, 4073], 'incubation': [4007, 4249], '20': [4009], '°C,': [4013], 'suspension': [4015, 4148, 4232], '5,000': [4019], 'supernatant': [4032], 'mixed': [4034], 'SDS': [4036], 'sample': [4037], 'subjected': [4040], 'SDS-PAGE/Western': [4043], 'polyvinylidene': [4046, 4050], 'difluoride': [4047, 4051], 'membrane.': [4048], 'immersed': [4054], 'overnight': [4055], 'PBS': [4060], 'casein,': [4063], '0.05%': [4064], 'Tween': [4065], '20,': [4066], 'anti-uPAR': [4070, 4159], '(Monozyme).': [4072], 'multiple': [4074], 'washings': [4075], 'membranes': [4077], 'incubated': [4079], 'visualized': [4090], 'Substrate."': [4097], 'Migration': [4098], 'previously,': [4105], 'micro-Boyden': [4108], 'chamber': [4109], 'determine': [4136], '0.1%': [4153], 'BSA': [4154], 'preincubated': [4156, 4219], '(50': [4161, 4167], 'μg/ml)': [4162, 4168, 4210, 4217], 'Ig': [4166, 4215], 'prior': [4172, 4223], 'seeding': [4174], 'upper': [4179], 'wells': [4180], 'Boyden': [4183], 'chamber.': [4184], 'When': [4185], 'urokinase-kringle': [4190], 'assessed,': [4199], '(20': [4209, 4216], 'total': [4213], 'placement': [4225], 'wells.': [4229], 'BSA.': [4240], 'evaluated': [4247], 'CO2': [4258], 'incubator.': [4259], 'Data': [4260], 'presented': [4262], 'peak': [4264], 'area': [4265], 'scanned': [4267], 'fields': [4268], 'stained': [4270], 'percentage': [4275], 'migrate': [4279], 'across': [4280], 'filter': [4282], 'control': [4285], 'chemotaxis.': [4286], 'Comparisons': [4287], 'under': [4291], "Student's": [4298], 't': [4299], 'test.': [4300], 'p': [4302], '<': [4303], '0.05': [4304], 'value': [4305], 'considered': [4307], 'statistically': [4308], 'significant.': [4309], 'All': [4310], 'results': [4311], 'mean': [4315], '±': [4316], 'S.E.': [4317], 'constructs': [4319], '(60': [4320], 'μg)': [4321], 'mCi': [4326], 'Na125I': [4328], '0.1': [4330], 'mg': [4331], 'IODO-GEN': [4333], '(Pierce)': [4334], '8': [4336], 'temperature': [4340], 'reaction': [4343], 'terminated': [4345], 'excessl-tyrosine.': [4347], 'PD-10': [4358], 'columns': [4359], 'equilibrated': [4363], 'Iodinated': [4366], 'could': [4368], '(95–98%)': [4371], 'trichloroacetic': [4373], 'had': [4376], 'specific': [4377], '3.0': [4380], '4.0': [4382], '105': [4384], 'cpm/pmol.': [4385], 'Binding': [4386]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2028798638', 'counts_by_year': [{'year': 2022, 'cited_by_count': 1}, {'year': 2021, 'cited_by_count': 2}, {'year': 2020, 'cited_by_count': 4}, {'year': 2019, 'cited_by_count': 1}, {'year': 2018, 'cited_by_count': 5}, {'year': 2017, 'cited_by_count': 2}, {'year': 2016, 'cited_by_count': 2}, {'year': 2015, 'cited_by_count': 2}, {'year': 2014, 'cited_by_count': 3}, {'year': 2013, 'cited_by_count': 2}, {'year': 2012, 'cited_by_count': 4}], 'updated_date': '2025-01-07T16:19:54.014114', 'created_date': '2016-06-24'}
Publication Information

Basic Information

Access and Citation

AI Researcher Chatbot

Primary Location

Authors

Topics

Keywords

Related Works
