Publication Information

{'id': 'https://openalex.org/W2019084495', 'doi': 'https://doi.org/10.7326/0003-4819-105-3-382', 'title': 'Chronic Hepatitis B in Asymptomatic Homosexual Men with Antibody to the Human Immunodeficiency Virus', 'display_name': 'Chronic Hepatitis B in Asymptomatic Homosexual Men with Antibody to the Human Immunodeficiency Virus', 'publication_year': 1986, 'publication_date': '1986-09-01', 'ids': {'openalex': 'https://openalex.org/W2019084495', 'doi': 'https://doi.org/10.7326/0003-4819-105-3-382', 'mag': '2019084495', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/3017169'}, 'language': 'en', 'primary_location': {'is_oa': False, 'landing_page_url': 'https://doi.org/10.7326/0003-4819-105-3-382', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S119722071', 'display_name': 'Annals of Internal Medicine', 'issn_l': '0003-4819', 'issn': ['0003-4819', '1539-3704'], 'is_oa': False, 'is_in_doaj': False, 'is_core': True, 'host_organization': 'https://openalex.org/P4310316812', 'host_organization_name': 'American College of Physicians', 'host_organization_lineage': ['https://openalex.org/P4310316812'], 'host_organization_lineage_names': ['American College of Physicians'], 'type': 'journal'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': False, 'oa_status': 'closed', 'oa_url': None, 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5106037895', 'display_name': 'Robert P. Perrillo', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1322918889', 'display_name': 'United States Department of Veterans Affairs', 'ror': 'https://ror.org/05rsv9s98', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1322918889']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Robert P. Perrillo', 'raw_affiliation_strings': ['Veterans Administration Medical Center'], 'affiliations': [{'raw_affiliation_string': 'Veterans Administration Medical Center', 'institution_ids': ['https://openalex.org/I1322918889']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5012104989', 'display_name': 'Fredric Regenstein', 'orcid': None}, 'institutions': [], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Fredric G. Regenstein', 'raw_affiliation_strings': ['Washington University School of Medicine'], 'affiliations': [{'raw_affiliation_string': 'Washington University School of Medicine', 'institution_ids': []}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5025090593', 'display_name': 'Stanford T. Roodman', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I47838141', 'display_name': 'Saint Louis University', 'ror': 'https://ror.org/01p7jjy08', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I47838141']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Stanford T. Roodman', 'raw_affiliation_strings': [' and St. Louis University School of Medicine'], 'affiliations': [{'raw_affiliation_string': ' and St. Louis University School of Medicine', 'institution_ids': ['https://openalex.org/I47838141']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': None, 'apc_paid': None, 'fwci': 2.634, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 117, 'citation_normalized_percentile': {'value': 0.936118, 'is_in_top_1_percent': False, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 97, 'max': 98}, 'biblio': {'volume': '105', 'issue': '3', 'first_page': '382', 'last_page': '382'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T12159', 'display_name': 'T-cell and Retrovirus Studies', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/2403', 'display_name': 'Immunology'}, 'field': {'id': 'https://openalex.org/fields/24', 'display_name': 'Immunology and Microbiology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T12159', 'display_name': 'T-cell and Retrovirus Studies', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/2403', 'display_name': 'Immunology'}, 'field': {'id': 'https://openalex.org/fields/24', 'display_name': 'Immunology and Microbiology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11560', 'display_name': 'Animal Disease Management and Epidemiology', 'score': 0.9982, 'subfield': {'id': 'https://openalex.org/subfields/1102', 'display_name': 'Agronomy and Crop Science'}, 'field': {'id': 'https://openalex.org/fields/11', 'display_name': 'Agricultural and Biological Sciences'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T10625', 'display_name': 'Herpesvirus Infections and Treatments', 'score': 0.9928, 'subfield': {'id': 'https://openalex.org/subfields/2713', 'display_name': 'Epidemiology'}, 'field': {'id': 'https://openalex.org/fields/27', 'display_name': 'Medicine'}, 'domain': {'id': 'https://openalex.org/domains/4', 'display_name': 'Health Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/hepatitis-b', 'display_name': 'Hepatitis B', 'score': 0.49023277}, {'id': 'https://openalex.org/keywords/asymptomatic-carrier', 'display_name': 'Asymptomatic carrier', 'score': 0.4701087}, {'id': 'https://openalex.org/keywords/immunodeficiency-syndrome', 'display_name': 'Immunodeficiency Syndrome', 'score': 0.41139835}], 'concepts': [{'id': 'https://openalex.org/C71924100', 'wikidata': 'https://www.wikidata.org/wiki/Q11190', 'display_name': 'Medicine', 'level': 0, 'score': 0.8375585}, {'id': 'https://openalex.org/C2777910003', 'wikidata': 'https://www.wikidata.org/wiki/Q1707292', 'display_name': 'Asymptomatic', 'level': 2, 'score': 0.6848956}, {'id': 'https://openalex.org/C159654299', 'wikidata': 'https://www.wikidata.org/wiki/Q79460', 'display_name': 'Antibody', 'level': 2, 'score': 0.67097765}, {'id': 'https://openalex.org/C159047783', 'wikidata': 'https://www.wikidata.org/wiki/Q7215', 'display_name': 'Virology', 'level': 1, 'score': 0.59881973}, {'id': 'https://openalex.org/C2777607303', 'wikidata': 'https://www.wikidata.org/wiki/Q641307', 'display_name': 'Immunodeficiency', 'level': 3, 'score': 0.51306164}, {'id': 'https://openalex.org/C2780593183', 'wikidata': 'https://www.wikidata.org/wiki/Q6844', 'display_name': 'Hepatitis B virus', 'level': 3, 'score': 0.50991}, {'id': 'https://openalex.org/C203014093', 'wikidata': 'https://www.wikidata.org/wiki/Q101929', 'display_name': 'Immunology', 'level': 1, 'score': 0.49665385}, {'id': 'https://openalex.org/C2777382497', 'wikidata': 'https://www.wikidata.org/wiki/Q6853', 'display_name': 'Hepatitis B', 'level': 2, 'score': 0.49023277}, {'id': 'https://openalex.org/C2522874641', 'wikidata': 'https://www.wikidata.org/wiki/Q808', 'display_name': 'Virus', 'level': 2, 'score': 0.47920617}, {'id': 'https://openalex.org/C137916694', 'wikidata': 'https://www.wikidata.org/wiki/Q1549382', 'display_name': 'Asymptomatic carrier', 'level': 3, 'score': 0.4701087}, {'id': 'https://openalex.org/C2776408679', 'wikidata': 'https://www.wikidata.org/wiki/Q708693', 'display_name': 'Hepatitis C virus', 'level': 3, 'score': 0.4537953}, {'id': 'https://openalex.org/C2910905871', 'wikidata': 'https://www.wikidata.org/wiki/Q641307', 'display_name': 'Immunodeficiency Syndrome', 'level': 4, 'score': 0.41139835}, {'id': 'https://openalex.org/C126322002', 'wikidata': 'https://www.wikidata.org/wiki/Q11180', 'display_name': 'Internal medicine', 'level': 1, 'score': 0.20661548}, {'id': 'https://openalex.org/C8891405', 'wikidata': 'https://www.wikidata.org/wiki/Q1059', 'display_name': 'Immune system', 'level': 2, 'score': 0.07454151}], 'mesh': [{'descriptor_ui': 'D000914', 'descriptor_name': 'Antibodies, Viral', 'qualifier_ui': 'Q000032', 'qualifier_name': 'analysis', 'is_major_topic': True}, {'descriptor_ui': 'D017977', 'descriptor_name': 'Deltaretrovirus', 'qualifier_ui': 'Q000276', 'qualifier_name': 'immunology', 'is_major_topic': True}, {'descriptor_ui': 'D006509', 'descriptor_name': 'Hepatitis B', 'qualifier_ui': 'Q000276', 'qualifier_name': 'immunology', 'is_major_topic': True}, {'descriptor_ui': 'D006716', 'descriptor_name': 'Homosexuality', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': True}, {'descriptor_ui': 'D000328', 'descriptor_name': 'Adult', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000410', 'descriptor_name': 'Alanine Transaminase', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000410', 'descriptor_name': 'Alanine Transaminase', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D000914', 'descriptor_name': 'Antibodies, Viral', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002353', 'descriptor_name': 'Carrier State', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002353', 'descriptor_name': 'Carrier State', 'qualifier_ui': 'Q000276', 'qualifier_name': 'immunology', 'is_major_topic': False}, {'descriptor_ui': 'D004259', 'descriptor_name': 'DNA-Directed DNA Polymerase', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004259', 'descriptor_name': 'DNA-Directed DNA Polymerase', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D017977', 'descriptor_name': 'Deltaretrovirus', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004797', 'descriptor_name': 'Enzyme-Linked Immunosorbent Assay', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D015483', 'descriptor_name': 'HIV Antibodies', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006509', 'descriptor_name': 'Hepatitis B', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006801', 'descriptor_name': 'Humans', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008297', 'descriptor_name': 'Male', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': False, 'landing_page_url': 'https://doi.org/10.7326/0003-4819-105-3-382', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S119722071', 'display_name': 'Annals of Internal Medicine', 'issn_l': '0003-4819', 'issn': ['0003-4819', '1539-3704'], 'is_oa': False, 'is_in_doaj': False, 'is_core': True, 'host_organization': 'https://openalex.org/P4310316812', 'host_organization_name': 'American College of Physicians', 'host_organization_lineage': ['https://openalex.org/P4310316812'], 'host_organization_lineage_names': ['American College of Physicians'], 'type': 'journal'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/3017169', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': None, 'sustainable_development_goals': [{'display_name': 'Good health and well-being', 'id': 'https://metadata.un.org/sdg/3', 'score': 0.87}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 8, 'referenced_works': ['https://openalex.org/W1529259838', 'https://openalex.org/W2084365352', 'https://openalex.org/W2086670006', 'https://openalex.org/W2087434243', 'https://openalex.org/W228805312', 'https://openalex.org/W2319169304', 'https://openalex.org/W2339155832', 'https://openalex.org/W2616538340'], 'related_works': ['https://openalex.org/W4246208182', 'https://openalex.org/W4232010458', 'https://openalex.org/W3164100745', 'https://openalex.org/W3032075143', 'https://openalex.org/W2977593866', 'https://openalex.org/W2513891742', 'https://openalex.org/W2214619184', 'https://openalex.org/W1977588072', 'https://openalex.org/W1970582747', 'https://openalex.org/W1967680436'], 'abstract_inverted_index': {'Brief': [0], 'Reports1': [1], 'September': [2, 1444, 1460], '1986Chronic': [3], 'Hepatitis': [4, 213, 244, 326, 410, 510, 542, 700, 713, 815, 870, 1124, 1136, 1297, 1368], 'B': [5, 245, 327, 340, 349, 398, 411, 428, 461, 477, 482, 490, 511, 518, 543, 553, 610, 677, 701, 714, 731, 753, 788, 795, 799, 807, 816, 871, 910, 921, 967, 993, 998, 1050, 1059, 1065, 1078, 1137, 1169, 1202, 1216, 1238, 1249, 1255, 1268, 1273, 1296, 1328, 1369, 1437], 'in': [6, 136, 154, 186, 200, 230, 248, 268, 296, 406, 415, 429, 462, 469, 485, 504, 512, 546, 556, 592, 621, 628, 692, 704, 717, 736, 754, 771, 782, 809, 818, 842, 852, 874, 885, 892, 915, 929, 952, 970, 976, 985, 994, 999, 1053, 1111, 1128, 1172, 1185, 1204, 1219, 1229, 1239, 1242, 1258, 1263, 1290, 1335, 1345, 1357, 1363, 1439], 'Asymptomatic': [7], 'Homosexual': [8, 876], 'Men': [9], 'with': [10, 105, 142, 338, 452, 471, 488, 506, 559, 599, 821, 844, 856, 881, 918, 932, 1001, 1095, 1116, 1174, 1231, 1350, 1359], 'Antibody': [11], 'to': [12, 45, 73, 79, 82, 113, 138, 291, 293, 311, 436, 569, 722, 734, 830, 878, 883, 939, 1005, 1120], 'the': [13, 53, 62, 66, 74, 95, 114, 124, 155, 231, 249, 266, 269, 351, 384, 567, 573, 683, 759, 783, 898, 977, 1069, 1264, 1291, 1364], 'Human': [14, 822, 865, 1129, 1276, 1360], 'Immunodeficiency': [15, 823, 866, 1130, 1277], 'VirusROBERT': [16], 'P.': [17, 28, 1302], 'PERRILLO,': [18, 29], 'M.D.,': [19, 23, 30, 34, 1376, 1380, 1384, 1387, 1390, 1394, 1410, 1424, 1428], 'FREDRIC': [20, 31], 'G.': [21, 32, 1306, 1310], 'REGENSTEIN,': [22, 33], 'STANFORD': [24, 35], 'T.': [25, 36], 'ROODMAN,': [26, 37], 'Ph.D.ROBERT': [27], 'Ph.D.Author,': [38], 'Article,': [39, 388], 'and': [40, 100, 167, 214, 262, 333, 359, 389, 400, 434, 439, 446, 449, 465, 474, 491, 516, 523, 544, 572, 609, 616, 634, 678, 682, 696, 715, 764, 779, 805, 812, 835, 839, 869, 897, 922, 933, 937, 965, 979, 1007, 1048, 1076, 1090, 1107, 1182, 1194, 1197, 1275, 1330], 'Disclosure': [41, 390], 'Informationhttps://doi.org/10.7326/0003-4819-105-3-382': [42], 'SectionsAboutPDF': [43], 'ToolsAdd': [44], 'favoritesDownload': [46], 'CitationsTrack': [47], 'CitationsPermissions': [48], 'ShareFacebookTwitterLinkedInRedditEmail': [49], 'ExcerptThe': [50], 'discovery': [51], 'of': [52, 65, 77, 140, 157, 160, 265, 286, 288, 308, 335, 353, 458, 480, 498, 541, 550, 563, 576, 580, 588, 606, 613, 637, 687, 698, 712, 724, 729, 745, 758, 761, 775, 785, 814, 827, 850, 864, 888, 900, 908, 942, 958, 973, 981, 990, 1057, 1061, 1063, 1085, 1105, 1123, 1134, 1164, 1167, 1200, 1266, 1271, 1293, 1339, 1366], 'human': [54, 125, 161, 560, 737, 746, 845, 924, 943, 962, 1042, 1072, 1092, 1205, 1232], 'immunodeficiency': [55, 68, 126, 169, 180, 251, 561, 738, 747, 846, 925, 944, 963, 1043, 1073, 1093, 1206, 1221, 1233], 'virus': [56, 115, 127, 163, 166, 246, 399, 483, 536, 554, 680, 732, 748, 808, 847, 911, 926, 945, 950, 964, 968, 1047, 1051, 1066, 1074, 1170, 1203, 1207, 1217, 1234, 1256, 1329], '(formerly': [57], 'known': [58], 'as': [59, 61, 121], 'HTLV-III/LAV)': [60], 'causative': [63], 'agent': [64], 'acquired': [67, 168, 179, 232, 250, 270, 1220], 'syndrome': [69, 273, 1222], '(AIDS)': [70, 1223], 'has': [71, 128], 'led': [72], 'commercial': [75], 'availability': [76], 'tests': [78, 103], 'detect': [80], 'antibody': [81, 112, 147], 'one': [83], 'or': [84, 478, 601], 'more': [85], 'viral': [86, 202, 475, 493, 590, 895, 905, 1079, 1183, 1333], 'coded': [87], 'proteins.': [88], 'The': [89, 284, 632], 'most': [90], 'frequently': [91], 'used': [92], 'method': [93, 107], 'is': [94, 375], 'enzyme-linked': [96], 'immunosorbent': [97, 1453], 'assay': [98], '(ELISA),': [99], 'reproducibly': [101], 'reactive': [102], 'done': [104], 'this': [106], 'are': [108], 'highly': [109, 499, 688], 'specific': [110], 'for': [111, 146, 152, 183, 314, 356, 422, 685, 860, 904, 961, 1433], '(1).': [116], 'In': [117], 'high-risk': [118], 'populations,': [119], 'such': [120], 'homosexual': [122, 297, 309, 755, 810, 971, 1240], 'men,': [123], 'been': [129], 'isolated': [130], 'from': [131, 912], 'a': [132, 143, 772, 886, 916, 1083, 1346], 'single': [133], 'blood': [134, 187, 354], 'specimen': [135], '67%': [137], '95%': [139], 'persons': [141], 'positive': [144, 355], 'test': [145], '(1,': [148], '2)....References1.': [149], '.': [150], 'Recommendations': [151], 'assisting': [153], 'prevention': [156], 'perinatal': [158], 'transmission': [159, 1190], 'T-lymphotropic': [162], 'type': [164, 1087], 'III/lymphadenopathy-associated': [165], 'syndrome.': [170, 235, 252], 'MMWR.': [171], '1985;34:721-6,': [172], '731-2.': [173], 'MedlineGoogle': [174, 240], 'Scholar2.': [175], 'FEORINOJAFFEPALMER': [176], 'PHE.': [177], 'Transfusion-associated': [178], 'syndrome:': [181], 'evidence': [182, 1209], 'persistent': [184], 'infection': [185, 247, 334, 473, 484, 555, 565, 749, 763, 946, 1067, 1094, 1171, 1334], 'donors.': [188], 'N': [189, 366], 'Engl': [190, 367], 'J': [191, 237, 276, 319, 368], 'Med.': [192, 255, 369], '1985;312:1293-6.': [193], 'CrossrefMedlineGoogle': [194, 280, 302, 344, 371], 'Scholar3.': [195], 'DIENSTAG': [196], 'J.': [197, 1014, 1317, 1412], 'Immunologic': [198], 'mechanisms': [199], 'chronic': [201, 316, 459, 551, 577, 589, 629, 751, 768, 786, 837, 857, 901, 919, 953, 982, 991, 1055, 1086, 1175, 1186, 1347], 'hepatitis.': [203], 'In:': [204], 'VYAS': [205], 'GN,': [206], 'DIENSTAG,': [207], 'JL,': [208], 'HOOFNAGLE': [209], 'JH,': [210], 'eds.': [211], 'Viral': [212, 861], 'Liver': [215], 'Disease.': [216], 'Orlando,': [217], 'Florida:': [218], 'Grune': [219], '&': [220], 'Stratton,': [221], 'Inc.;': [222], '1984:135-66.': [223], 'Google': [224], 'Scholar4.': [225], "REICHERTO'LEARYLEVENSSIMRELLMACHER": [226], 'CTDCA.': [227], 'Autopsy': [228], 'pathology': [229], 'immune': [233, 271, 1117], 'deficiency': [234, 272, 1118], 'Am': [236, 275], 'Pathol.': [238, 278], '1983;112:357-82.': [239], 'Scholar5.': [241], 'RUSTGIHOOFNAGLEGERIN': [242], 'VJJ.': [243], 'Ann': [253], 'Intern': [254], '1984;101:795-7.': [256], 'LinkGoogle': [257], 'Scholar6.': [258], 'GLASGOWANDERSLAYFIELDSTEINSAPIRGITNICKLEWIN': [259], 'BKLKGK.': [260], 'Clinical': [261], 'pathologic': [263], 'findings': [264], 'liver': [267, 317, 440, 641, 974, 983, 1351], '(AIDS).': [274], 'Clin': [277], '1985;83:582-8.': [279], 'Scholar7.': [281], 'DOBOZINJUDSONCOHN': [282], 'BFD.': [283], 'relationship': [285, 938], 'abnormalities': [287], 'cellular': [289], 'immunity': [290], 'antibodies': [292], 'HTLV': [294], 'III': [295], 'men.': [298], 'Cell': [299], 'Immunol.': [300], '1986;98:156-71.': [301], 'Scholar8.': [303], 'NOVICKLOKTHOMAS': [304], 'DAH.': [305], 'Diminished': [306], 'responsiveness': [307], 'men': [310], 'antiviral': [312], 'therapy': [313, 442, 451, 502, 571, 691], 'HBsAg-positive': [315, 1112], 'disease.': [318], 'Hepatol.': [320], '1984;1:29-35.': [321], 'CrossrefGoogle': [322], 'Scholar9.': [323], 'PERRILLOGELBCAMPBELL': [324], 'RLC.': [325], 'e': [328, 357], 'antigen,': [329], 'DNA': [330, 360, 1257], 'polymerase': [331, 361], 'activity,': [332], 'household': [336], 'contacts': [337], 'hepatitis': [339, 460, 476, 481, 539, 552, 578, 591, 607, 630, 730, 752, 769, 787, 806, 858, 896, 909, 920, 948, 966, 992, 1045, 1049, 1058, 1064, 1077, 1089, 1168, 1176, 1187, 1201, 1215, 1228, 1237, 1267, 1331, 1436, 1450], 'virus.': [341], 'Gastroenterology.': [342], '1979;76:1319-25.': [343], 'Scholar10.': [345], 'ALTERSEEFFKAPLAN': [346], 'HLP.': [347], 'Type': [348, 1295], 'hepatitis:': [350, 1082], 'infectivity': [352], 'antigen': [358], 'after': [362, 1138], 'accidental': [363], 'needlestick': [364], 'exposure.': [365], '1976;295:909-13.': [370], 'Scholar': [372], 'This': [373], 'content': [374], 'PDF': [376, 385, 1462], 'only.': [377], 'To': [378], 'continue': [379], 'reading': [380], 'please': [381], 'click': [382], 'on': [383, 566, 750, 767, 947, 1068, 1342, 1435], 'icon.': [386], 'Author,': [387], 'InformationAffiliations:': [391], 'PreviousarticleNextarticle': [392], 'Advertisement': [393], 'FiguresReferencesRelatedDetails': [394], 'Metrics': [395], 'Cited': [396], 'ByHepatitis': [397], 'HIV': [401, 472, 508, 524, 547, 564, 762, 804, 884, 1002, 1103, 1340], 'coinfections': [402], 'can': [403], 'be': [404], 'interpreted': [405], 'different': [407], 'waysThe': [408], 'Recombinant': [409, 1287], 'Surface': [412], 'Antigen': [413], 'Vaccine': [414], 'Persons': [416], 'With': [417, 583, 618, 625, 708], 'HIV:': [418, 430], 'Is': [419], 'Seroconversion': [420], 'Sufficient': [421], 'Long-term': [423], 'Protection?HIV': [424], 'Co-Infection': [425], 'Drug': [426, 706], 'ToxicityHepatitis': [427], 'Available': [431], 'treatment': [432, 784, 989], 'options': [433], 'approach': [435], 'therapyAntiretroviral': [437], 'drugs': [438], 'injuryAntiretroviral': [441], '2006:': [443], 'Pharmacology,': [444], 'applications,': [445], 'special': [447], 'situationsHepatotoxicity': [448], 'antiretroviral': [450, 501, 603, 690], 'protease': [453], 'inhibitors:': [454], 'A': [455, 467, 1298, 1370], 'reviewNatural': [456], 'history': [457, 636], 'co-infected': [463, 558], 'patientsHepatotoxicity': [464], 'Nelfinavir:': [466], 'Meta-AnalysisSurvival': [468], 'patients': [470, 486, 505, 557, 843, 855, 931, 1173, 1230], 'CTreatment': [479], 'coinfected': [487], 'HIVHepatitis': [489], 'C': [492, 545, 608, 679, 716, 770, 928], 'load': [494], 'changes': [495], 'following': [496], 'initiation': [497], 'active': [500, 689], '(HAART)': [503], 'advanced': [507, 923], 'infectionOccult': [509], 'HIV-Infected': [513], 'PatientsAntiretroviral': [514], 'Therapy': [515], 'HIV/Hepatitis': [517], 'Virus': [519, 702, 817, 867, 872, 1131, 1278], 'CoinfectionImmunizations,': [520], 'Vaccine-Preventable': [521], 'Diseases,': [522], 'InfectionAvances': [525], 'en': [526, 671], 'el': [527, 535], 'diagnóstico': [528], 'y': [529, 666], 'tratamiento': [530], 'de': [531, 537, 669], 'la': [532, 538], 'infección': [533], 'por': [534], 'BManagement': [540], 'Co-Infected': [548], 'PatientsTreatment': [549], 'virusInfluence': [562], 'response': [568], 'interferon': [570], 'long-term': [574], 'outcome': [575], 'BLack': [579], 'Hepatotoxicity': [581, 615], 'Associated': [582], 'Nonnucleoside': [584], 'Reverse': [585], 'Transcriptase': [586], 'InhibitorsManagement': [587], 'HIV-infected': [593, 930], 'patients:': [594], 'Spanish': [595], 'Consensus': [596], 'ConferenceHepatotoxicity': [597], 'associated': [598, 880], 'nevirapine': [600], 'efavirenz-containing': [602], 'therapy:': [604], 'Role': [605], 'infectionsLow': [611], 'Frequency': [612], 'Severe': [614], 'Association': [617], 'HCV': [619], 'Coinfection': [620], 'HIV-Positive': [622], 'Patients': [623, 819, 1000], 'Treated': [624], 'HAARTAcute': [626], 'flares': [627], 'B:': [631, 1189], 'natural': [633], 'unnatural': [635], 'an': [638, 995], 'immunologically': [639], 'mediated': [640], 'diseaseRESULTS': [642], 'ON': [643], 'PREEMPTIVE': [644], 'OR': [645], 'PROPHYLACTIC': [646], 'TREATMENT': [647, 659, 1098], 'OF': [648, 742, 790, 1099, 1247], 'LAMIVUDINE': [649], 'IN': [650, 1250], 'HBsAg': [651, 954, 1348], '(+)': [652], 'RENAL': [653], 'ALLOGRAFT': [654], 'RECIPIENTS:': [655], 'COMPARISON': [656], 'WITH': [657, 663, 1102, 1253], 'SALVAGE': [658], 'AFTER': [660], 'HEPATIC': [661], 'DYSFUNCTION': [662], 'HBV': [664, 879, 1106, 1343], 'RECURRENCEFrecuencia': [665], 'factores': [667], 'predictivos': [668], 'hepatotoxicidad': [670], 'pacientes': [672], 'que': [673], 'reciben': [674], 'terapia': [675], 'antirretroviralHepatitis': [676], 'co-infection': [681], 'risk': [684, 959], 'hepatotoxicity': [686], 'HIV-1': [693], 'infectionPrevalence,': [694], 'Patterns,': [695], 'Course': [697], 'Past': [699], 'Infection': [703, 868, 873], 'Intravenous': [705], 'Users': [707], 'Hiv-1': [709], 'InfectionThe': [710], 'Pervalence': [711], 'HIV-positive': [718, 854, 996], 'Greek': [719], 'Patients:': [720], 'Relationship': [721, 1004], 'Survival': [723], 'Deceased': [725], 'AIDS': [726, 1006], 'PatientsLong-term': [727], 'incidence': [728], 'resistance': [733], 'lamivudine': [735], 'virus-infected': [739], 'patientsINTERFERON': [740], 'THERAPY': [741], 'HEPATITIS': [743, 794, 798, 1248], 'BInfluence': [744], 'menRetrospective': [756], 'analysis': [757], 'impact': [760], 'alcohol': [765], 'use': [766], 'large': [773], 'cohort': [774, 887], 'drug': [776, 890, 1114], 'usersREVIEW:': [777], 'Present': [778], 'future': [780], 'directions': [781], 'infectionRISKS': [789], 'TRANSPLANTING': [791], 'KIDNEYS': [792], 'FROM': [793], 'SURFACE': [796], 'ANTIGEN-NEGATIVE,': [797], 'CORE': [800], 'ANTIBODY-POSITIVE': [801], 'DONORS1,2Interactions': [802], 'between': [803, 1041, 1071, 1178], 'menCoinfection': [811], 'Superinfection': [813], 'Infected': [820, 875], 'Virus:': [824], 'No': [825], 'Evidence': [826], 'Faster': [828], 'Progression': [829], 'AIDSAGA': [831], 'technical': [832], 'review:': [833], 'Malnutrition': [834], 'cachexia,': [836], 'diarrhea,': [838], 'hepatobiliary': [840], 'disease': [841, 984], 'infectionLong-term': [848], 'effects': [849], 'interferon-α': [851], 'five': [853], 'BInterferon-α': [859], 'HepatitisThe': [862], 'Interaction': [863], 'MenSeroconversion': [877], 'seroconversion': [882], 'intravenous': [889, 1113], 'misusers': [891], 'Turin,': [893], 'ItalyChronic': [894], 'management': [899, 980], 'renal': [902, 986, 1243, 1336, 1440], 'failureInterferons': [903], 'hepatitisSustained': [906], 'elimination': [907], 'serum': [913], 'induced': [914], 'patient': [917, 940], 'infectionHepatitis': [927], 'without': [934], 'AIDS:': [935], 'Prevalence': [936], 'survivalInfluence': [941], 'δ': [949], 'superinfection': [951, 1341], 'carriersHepatitis': [955], 'VirusesA': [956], 'comparison': [957], 'factors': [960], 'infections': [969, 1052], 'menValue': [972], 'biopsy': [975], 'evaluation': [978, 1265], 'transplant': [987, 1244, 1337, 1441], 'recipientsFoscarnet': [988], 'patientHepatitis': [997], 'Infection:': [1003], 'Patient': [1008], 'SurvivalBruce': [1009], 'F.': [1010, 1034], 'Scharschmidt,': [1011], 'MD,': [1012, 1020, 1024, 1028, 1032, 1036, 1142, 1145, 1153, 1158, 1304, 1308, 1312, 1315], 'Michael': [1013, 1038], 'Held,': [1015], 'MA,': [1016], 'Harry': [1017], 'H.': [1018, 1160], 'Hollander,': [1019], 'Alexandra': [1021], 'E.': [1022, 1026, 1151], 'Read,': [1023], 'Joel': [1025], 'Lavine,': [1027], 'PhD,': [1029, 1146], 'Genevieve': [1030], 'Veereman,': [1031], 'Richard': [1033], 'McGuire,': [1035], 'M.': [1037, 1155], 'Thaler,': [1039], 'MDInteractions': [1040], 'virus-1,': [1044], 'delta': [1046], '260': [1054], 'carriers': [1056], 'virusEffect': [1060], 'duration': [1062], 'association': [1070], 'type-1': [1075], 'replicationSexually': [1080], 'transmitted': [1081], 'review.Treatment': [1084], 'D': [1088], 'concomitant': [1091], 'α-interferonDIAGNOSIS': [1096], 'AND': [1097], 'SUBSTANCE': [1100], 'USERS': [1101], 'INFECTIONLack': [1104], 'HDV': [1108], 'replicative': [1109], 'activity': [1110], 'addicts': [1115], 'due': [1119], 'HIVHIV-positive': [1121], 'womenRemission': [1122], 'B-Associated': [1125], 'Membranous': [1126], 'Glomerulonephritis': [1127], 'InfectionLong-Term': [1132], 'Remission': [1133], 'Chronic': [1135, 1294, 1367], 'Alpha-Interferon': [1139], 'TherapyJulia': [1140], 'Korenman,': [1141], 'Bennie': [1143], 'Baker,': [1144], 'Jeanne': [1147], 'Waggoner,': [1148], 'BA,': [1149], 'James': [1150], 'Everhart,': [1152], 'Adrian': [1154], 'Di': [1156], 'Bisceglie,': [1157], 'Jay': [1159], 'Hoofnagle,': [1161], 'MDClinical': [1162], 'course': [1163], 'spontaneous': [1165], 'reactivation': [1166], 'BRelationship': [1177], 'histology,': [1179], 'aminotransferase': [1180], 'levels,': [1181], 'replication': [1184, 1218, 1344], 'BHepatitis': [1188], 'by': [1191, 1286], 'sexual': [1192], 'contact': [1193], 'needle': [1195], 'sharingHistological': [1196], 'immunohistochemical': [1198], 'study': [1199], 'infection.Preliminary': [1208], 'that': [1210], 'azidothymidine': [1211], 'does': [1212], 'not': [1213], 'affect': [1214], 'patientsRapidly': [1224], 'progressive': [1225], 'non-A,': [1226], 'non-B': [1227], 'infectionVaccination': [1235], 'against': [1236], 'menHepatitis': [1241], 'recipientsCLINICAL': [1245], 'REACTIVATION': [1246], 'ANTI-HBs-POSITIVE': [1251], 'PATIENTS': [1252], 'AIDSHepatitis': [1254, 1272], 'serum.': [1259], 'Applied': [1260], 'molecular': [1261], 'biology': [1262], 'infectionHepatobiliary': [1269], 'Abnormalities': [1270], 'Prevention': [1274], '(HIV)': [1279], 'InfectionStephen': [1280], 'C.': [1281, 1325, 1430], 'Hadler,': [1282], 'MDPrednisone': [1283], 'Withdrawal': [1284], 'Followed': [1285], 'Alpha': [1288], 'Interferon': [1289, 1362], 'Treatment': [1292, 1365], 'Randomized,': [1299, 1371], 'Controlled': [1300], 'TrialRobert': [1301], 'Perrillo,': [1303], 'Fredric': [1305], 'Regenstein,': [1307], 'Marion': [1309], 'Peters,': [1311], 'Katherine': [1313], 'DeSchryver-Kecskemeti,': [1314], 'Carol': [1316], 'Bodicky,': [1318], 'RN,': [1319], 'Carolyn': [1320], 'R.': [1321], 'Campbell,': [1322], 'BS,': [1323], 'Mary': [1324], 'Kuhns,': [1326], 'PhDHepatitisHepatitis': [1327], 'B-related': [1332], 'recipientsEffects': [1338], 'carrier': [1349], 'diseaseAdenine': [1352], 'Arabinoside': [1353], 'Monophosphate': [1354], '(Vidarabine': [1355], 'Phosphate)': [1356], 'Combination': [1358], 'Leukocyte': [1361], 'Double-Blinded,': [1372], 'Placebo-Controlled': [1373], 'TrialGABRIEL': [1374], 'GARCIA,': [1375], 'COLEMAN': [1377], 'I.': [1378, 1382], 'SMITH,': [1379], 'JED': [1381], 'WEISSBERG,': [1383], 'MARK': [1385], 'EISENBERG,': [1386], 'JACK': [1388], 'BISSETT,': [1389], 'PREM': [1391], 'V.': [1392], 'NAIR,': [1393], 'BARBARA': [1395], 'MASTRE,': [1396], 'R.N.,': [1397, 1400, 1403, 1406], 'SUE': [1398], 'ROSNO,': [1399], 'DEBBIE': [1401], 'ROSKAMP,': [1402], 'KAREN': [1404], 'WATERMAN,': [1405], 'RICHARD': [1407], 'B.': [1408, 1426], 'POLLARD,': [1409], 'MYRON': [1411], 'TONG,': [1413], 'MD.,': [1414], 'Ph.D.,': [1415, 1420], 'BYRON': [1416], 'W.': [1417], 'BROWN': [1418], 'Jr.,': [1419], 'WILLIAM': [1421], 'S.': [1422], 'ROBINSON,': [1423], 'PETER': [1425], 'GREGORY,': [1427], 'THOMAS': [1429], 'MERIGAN,': [1431], 'M.D.Time': [1432], 'action': [1434], 'immunisation.Hepatitis': [1438], 'recipients': [1442], '1': [1443, 1459], '1986Volume': [1445], '105,': [1446], 'Issue': [1447, 1457], '3Page:': [1448], '382-383KeywordsAIDSChronic': [1449], 'BEnzyme': [1451], 'linked': [1452], 'assayHIVHematologic': [1454], 'testsHomosexualsPopulation': [1455], 'statisticsProteins': [1456], 'Published:': [1458], '1986': [1461], 'DownloadLoading': [1463], '...': [1464]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2019084495', 'counts_by_year': [{'year': 2016, 'cited_by_count': 1}, {'year': 2013, 'cited_by_count': 1}, {'year': 2012, 'cited_by_count': 3}], 'updated_date': '2024-12-07T23:14:33.271501', 'created_date': '2016-06-24'}