Publication Information

{'id': 'https://openalex.org/W2016415814', 'doi': 'https://doi.org/10.1074/jbc.273.21.13203', 'title': 'Specific Inhibition of in Vitro Formation of Protease-resistant Prion Protein by Synthetic Peptides', 'display_name': 'Specific Inhibition of in Vitro Formation of Protease-resistant Prion Protein by Synthetic Peptides', 'publication_year': 1998, 'publication_date': '1998-05-01', 'ids': {'openalex': 'https://openalex.org/W2016415814', 'doi': 'https://doi.org/10.1074/jbc.273.21.13203', 'mag': '2016415814', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/9582363'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.273.21.13203', 'pdf_url': 'http://www.jbc.org/article/S0021925819579352/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925819579352/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5026834670', 'display_name': 'Joëlle Chabry', 'orcid': 'https://orcid.org/0000-0002-5513-9224'}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Joe¨lle Chabry', 'raw_affiliation_strings': ['From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5015110041', 'display_name': 'Byron Caughey', 'orcid': 'https://orcid.org/0000-0002-3928-6101'}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Byron Caughey', 'raw_affiliation_strings': ['From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840', 'institution_ids': ['https://openalex.org/I1299303238']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5032220933', 'display_name': 'Bruce Chesebro', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I1299303238', 'display_name': 'National Institutes of Health', 'ror': 'https://ror.org/01cwqze88', 'country_code': 'US', 'type': 'government', 'lineage': ['https://openalex.org/I1299022934', 'https://openalex.org/I1299303238']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Bruce Chesebro', 'raw_affiliation_strings': ['From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840'], 'affiliations': [{'raw_affiliation_string': 'From the Laboratory of Persistent Viral Diseases, NIAID, National Institutes of Health, Rocky Mountain Laboratories, Hamilton, Montana 59840', 'institution_ids': ['https://openalex.org/I1299303238']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 1, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 4.833, 'has_fulltext': True, 'fulltext_origin': 'pdf', 'cited_by_count': 179, 'citation_normalized_percentile': {'value': 0.929053, 'is_in_top_1_percent': False, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 97, 'max': 98}, 'biblio': {'volume': '273', 'issue': '21', 'first_page': '13203', 'last_page': '13207'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T11335', 'display_name': 'Prion Diseases and Protein Misfolding', 'score': 0.9999, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T11335', 'display_name': 'Prion Diseases and Protein Misfolding', 'score': 0.9999, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T13481', 'display_name': 'Neurological diseases and metabolism', 'score': 0.9472, 'subfield': {'id': 'https://openalex.org/subfields/2808', 'display_name': 'Neurology'}, 'field': {'id': 'https://openalex.org/fields/28', 'display_name': 'Neuroscience'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [], 'concepts': [{'id': 'https://openalex.org/C202751555', 'wikidata': 'https://www.wikidata.org/wiki/Q221681', 'display_name': 'In vitro', 'level': 2, 'score': 0.7580137}, {'id': 'https://openalex.org/C2776714187', 'wikidata': 'https://www.wikidata.org/wiki/Q212410', 'display_name': 'Protease', 'level': 3, 'score': 0.63475335}, {'id': 'https://openalex.org/C3019804061', 'wikidata': 'https://www.wikidata.org/wiki/Q14881255', 'display_name': 'Prion protein', 'level': 3, 'score': 0.5771684}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.5316736}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.34781247}, {'id': 'https://openalex.org/C159047783', 'wikidata': 'https://www.wikidata.org/wiki/Q7215', 'display_name': 'Virology', 'level': 1, 'score': 0.32499063}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.28130168}, {'id': 'https://openalex.org/C71924100', 'wikidata': 'https://www.wikidata.org/wiki/Q11190', 'display_name': 'Medicine', 'level': 0, 'score': 0.21656457}, {'id': 'https://openalex.org/C181199279', 'wikidata': 'https://www.wikidata.org/wiki/Q8047', 'display_name': 'Enzyme', 'level': 2, 'score': 0.17501613}, {'id': 'https://openalex.org/C142724271', 'wikidata': 'https://www.wikidata.org/wiki/Q7208', 'display_name': 'Pathology', 'level': 1, 'score': 0.111695886}, {'id': 'https://openalex.org/C2779134260', 'wikidata': 'https://www.wikidata.org/wiki/Q12136', 'display_name': 'Disease', 'level': 2, 'score': 0.0}], 'mesh': [{'descriptor_ui': 'D010450', 'descriptor_name': 'Endopeptidases', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': True}, {'descriptor_ui': 'D011328', 'descriptor_name': 'Prions', 'qualifier_ui': 'Q000037', 'qualifier_name': 'antagonists & inhibitors', 'is_major_topic': True}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000818', 'descriptor_name': 'Animals', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D006224', 'descriptor_name': 'Cricetinae', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010450', 'descriptor_name': 'Endopeptidases', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D011328', 'descriptor_name': 'Prions', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011328', 'descriptor_name': 'Prions', 'qualifier_ui': 'Q000096', 'qualifier_name': 'biosynthesis', 'is_major_topic': False}, {'descriptor_ui': 'D011487', 'descriptor_name': 'Protein Conformation', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D017550', 'descriptor_name': 'Spectroscopy, Fourier Transform Infrared', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.273.21.13203', 'pdf_url': 'http://www.jbc.org/article/S0021925819579352/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/9582363', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.273.21.13203', 'pdf_url': 'http://www.jbc.org/article/S0021925819579352/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [{'id': 'https://metadata.un.org/sdg/6', 'display_name': 'Clean water and sanitation', 'score': 0.41}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 24, 'referenced_works': ['https://openalex.org/W1498054718', 'https://openalex.org/W1567267284', 'https://openalex.org/W1584074575', 'https://openalex.org/W1702780721', 'https://openalex.org/W1784563469', 'https://openalex.org/W1972409470', 'https://openalex.org/W1992084965', 'https://openalex.org/W1998038512', 'https://openalex.org/W2008789887', 'https://openalex.org/W2011108781', 'https://openalex.org/W2016166584', 'https://openalex.org/W2022392367', 'https://openalex.org/W2028469737', 'https://openalex.org/W2032843390', 'https://openalex.org/W2034415720', 'https://openalex.org/W204422148', 'https://openalex.org/W2061150431', 'https://openalex.org/W2094337931', 'https://openalex.org/W2097484192', 'https://openalex.org/W2099576534', 'https://openalex.org/W2108743895', 'https://openalex.org/W2110420813', 'https://openalex.org/W2154010286', 'https://openalex.org/W2163612750'], 'related_works': ['https://openalex.org/W314815708', 'https://openalex.org/W2391339579', 'https://openalex.org/W2381515630', 'https://openalex.org/W2379938146', 'https://openalex.org/W2361364942', 'https://openalex.org/W2358847771', 'https://openalex.org/W2355642964', 'https://openalex.org/W2350506131', 'https://openalex.org/W1983970916', 'https://openalex.org/W1969181144'], 'abstract_inverted_index': {'The': [0, 114, 205, 240, 354, 445, 1353, 1428, 1558, 1641, 1729, 1770, 1784, 1807, 2000, 2046, 2081, 2184, 2202, 2351, 2506, 2529, 2605, 2685, 2805, 3213, 3579, 3677, 4039], 'transmissible': [1, 241, 489], 'spongiform': [2, 242, 481, 490, 539], 'encephalopathies': [3, 243, 482], 'are': [4, 228, 244, 468, 518, 579, 747, 823, 1052, 2910, 3449, 3475, 3568], 'characterized': [5, 245, 580], 'by': [6, 111, 246, 351, 581, 605, 1358, 1385, 1441, 1503, 1562, 1576, 1616, 1689, 1735, 1779, 2005, 2075, 2088, 2107, 2207, 2421, 2596, 3077, 3221, 3844, 4060, 4065], 'the': [7, 10, 22, 38, 51, 72, 81, 89, 93, 97, 108, 122, 152, 155, 171, 193, 198, 209, 214, 219, 232, 247, 250, 262, 278, 291, 312, 321, 329, 333, 337, 348, 362, 392, 395, 411, 433, 438, 449, 454, 459, 472, 582, 617, 715, 720, 726, 737, 751, 819, 828, 868, 1261, 1271, 1282, 1294, 1298, 1311, 1321, 1326, 1330, 1347, 1359, 1431, 1434, 1514, 1563, 1650, 1724, 1773, 1944, 1951, 1954, 1962, 1990, 2006, 2084, 2089, 2092, 2102, 2113, 2118, 2121, 2150, 2165, 2168, 2171, 2187, 2248, 2253, 2297, 2309, 2314, 2324, 2340, 2356, 2373, 2395, 2399, 2409, 2417, 2425, 2438, 2476, 2488, 2504, 2513, 2520, 2537, 2552, 2573, 2591, 2599, 2619, 2625, 2660, 2663, 2691, 2707, 2713, 2718, 2728, 2732, 2750, 2762, 2774, 2783, 2789, 2817, 2820, 2831, 2857, 2860, 2917, 2993, 3001, 3030, 3047, 3056, 3069, 3072, 3099, 3121, 3156, 3159, 3163, 3175, 3186, 3201, 3216, 3234, 3238, 3264, 3290, 3293, 3303, 3306, 3311, 3349, 3363, 3375, 3386, 3396, 3401, 3414, 3425, 3435, 3440, 3443, 3447, 3453, 3465, 3468, 3479, 3483, 3547, 3575, 3595, 3631, 3636, 3658, 3664, 3670, 3682, 3689, 3693, 3705, 3721, 3725, 3819, 3823, 3827, 3865, 3874, 3907, 3983, 4046, 4080, 4108, 4111, 4142], 'conversion': [8, 39, 68, 109, 156, 248, 279, 308, 349, 396, 869, 1313, 1348, 1809, 1929, 2085, 2210, 2343, 2358, 2426, 2515, 2540, 2577, 2592, 2714, 2790, 2821, 2887, 3073, 3085, 3093, 3160, 3205, 3218, 3307, 3387, 3397, 3706, 3722, 4014, 4088], 'of': [9, 35, 40, 71, 96, 116, 154, 163, 189, 197, 208, 221, 224, 249, 275, 280, 311, 336, 356, 394, 403, 429, 437, 448, 461, 464, 586, 593, 619, 712, 722, 729, 731, 795, 830, 870, 1079, 1268, 1284, 1291, 1297, 1323, 1329, 1349, 1361, 1364, 1416, 1433, 1499, 1510, 1536, 1565, 1568, 1684, 1731, 1772, 1781, 1896, 1899, 1916, 1925, 1928, 1948, 1953, 2008, 2011, 2014, 2035, 2083, 2095, 2117, 2124, 2143, 2154, 2157, 2167, 2243, 2344, 2364, 2383, 2394, 2401, 2416, 2427, 2440, 2443, 2454, 2509, 2536, 2602, 2662, 2698, 2717, 2734, 2737, 2765, 2770, 2777, 2807, 2809, 2819, 2859, 2898, 2907, 2916, 2935, 2953, 2992, 3006, 3027, 3037, 3051, 3058, 3071, 3080, 3086, 3103, 3123, 3141, 3147, 3158, 3174, 3189, 3215, 3237, 3292, 3305, 3404, 3417, 3438, 3446, 3473, 3549, 3597, 3633, 3660, 3679, 3681, 3695, 3822, 3838, 3873, 3879, 3898, 3909, 3982, 3986, 4041, 4048, 4079, 4087, 4093, 4110, 4120, 4141], 'protease-sensitive': [11, 251, 496, 595], 'prion': [12, 252, 493, 497, 501, 597], 'protein': [13, 253, 505, 598, 1398, 1619, 2626], '(PrPsen)': [14, 254], 'into': [15, 255, 1420, 2231, 2349, 3274], 'a': [16, 45, 256, 285, 606, 612, 709, 792, 861, 1076, 1266, 1306, 1335, 1343, 1392, 1414, 1504, 1739, 1747, 1922, 2012, 2240, 2261, 2292, 2361, 2377, 2430, 2870, 2905, 2936, 2968, 3007, 3019, 3034, 3259, 3275, 3618, 3623, 3732, 3910, 3997], 'protease-resistant': [17, 257, 500], 'isoform': [18, 258, 591, 3278], '(PrPres)': [19, 259, 592], 'associated': [20, 260, 703], 'with': [21, 213, 261, 453, 704, 904, 1075, 1188, 1195, 1507, 1519, 1582, 1723, 1884, 1913, 1967, 2140, 2209, 2235, 2260, 2380, 2451, 2694, 2727, 2989, 3126, 3302, 3464, 3606, 3617, 3718, 3854, 3901, 4025, 4096, 4107], 'neuropathogenic': [23, 263], 'process': [24, 264, 608], 'in': [25, 44, 47, 218, 231, 265, 284, 287, 458, 471, 532, 535, 541, 714, 719, 725, 783, 789, 805, 818, 863, 918, 1037, 1040, 1054, 1270, 1346, 1410, 1496, 1533, 1571, 1646, 1795, 1921, 1943, 1973, 2032, 2050, 2149, 2296, 2313, 2331, 2341, 2355, 2369, 2408, 2624, 2667, 2678, 2692, 2731, 2886, 2912, 3064, 3098, 3120, 3181, 3199, 3202, 3281, 3413, 3452, 3457, 3574, 3594, 3635, 3663, 3669, 3906, 4003, 4011, 4050], 'vivo.': [26, 266], 'Recently,': [27, 267, 3240], 'PrPres': [28, 43, 190, 225, 238, 268, 283, 430, 465, 478, 600, 700, 713, 744, 787, 799, 831, 866, 873, 900, 1049, 1055, 1285, 1341, 1679, 1732, 1786, 1880, 2125, 2576, 3231, 3458, 3474, 3634, 3675, 3696, 3713, 3739, 4007, 4009, 4049], 'has': [29, 269, 2615], 'been': [30, 270, 2616], 'shown': [31, 271, 1185, 2330, 2368, 2911, 3895], 'to': [32, 42, 62, 77, 80, 103, 129, 173, 185, 237, 272, 282, 302, 317, 320, 343, 369, 413, 425, 477, 825, 872, 1072, 1186, 1280, 1351, 1618, 1792, 2022, 2239, 2251, 2290, 2307, 2389, 2423, 2429, 2474, 2502, 2533, 2545, 2571, 2575, 2613, 2711, 2743, 2755, 2758, 2761, 2815, 2836, 2855, 2865, 2951, 3032, 3062, 3171, 3268, 3299, 3344, 3348, 3393, 3424, 3478, 3556, 3571, 3585, 3588, 3674, 3700, 3703, 3712, 3737, 3847, 3883, 4001, 4005, 4044, 4053, 4091, 4101], 'be': [33, 178, 273, 418, 2546, 2759, 3041, 3075, 3179, 3345, 3572, 3841, 3996, 4054], 'capable': [34, 274, 3878], 'directly': [36, 276], 'inducing': [37, 277], 'PrPsen': [41, 83, 227, 281, 323, 467, 604, 723, 746, 801, 871, 902, 1051, 1189, 1339, 1350, 1623, 1644, 2347, 2574, 2730, 2744, 2891, 3148, 3229, 3701, 3900], 'cell-free': [46, 67, 286, 307, 862, 1287, 1312, 1808, 2357, 2514, 3204, 3217, 4013], 'vitro': [48, 288, 790, 864, 2342, 3203], 'system.': [49, 289], 'In': [50, 290, 860, 1060, 1260, 2398, 2412, 2437, 2561, 2705, 3162, 3286, 3544, 3720, 3869], 'present': [52, 292, 3164], 'experiments,': [53, 293, 1062, 3546, 4015], 'various': [54, 294, 3104], 'PrP': [55, 99, 295, 339, 821, 1068, 1182, 1273, 1299, 1331, 1742, 1750, 2318, 2327, 2480, 2539, 2603, 2606, 2861, 2974, 3060, 3168, 3190, 3262, 3550, 3665, 4030, 4042, 4057], 'peptides': [56, 74, 91, 146, 165, 184, 296, 314, 331, 386, 405, 424, 1065, 1183, 1264, 1292, 1355, 1407, 2119, 2158, 2204, 2352, 2418, 2525, 2553, 2597, 2675, 2739, 2766, 2795, 2864, 2880, 2899, 2918, 2959, 2975, 3003, 3061, 3129, 3134, 3170, 3223, 3312, 3684, 3691, 3709, 3726, 3825, 3858, 3876, 4043, 4058], 'were': [57, 167, 297, 407, 1184, 1275, 1356, 1380, 1408, 1436, 1488, 1516, 1560, 1614, 1718, 2029, 2048, 2173, 2189, 2205, 2229, 2258, 2268, 2285, 2335, 2353, 2406, 2449, 2472, 2543, 2796, 2844, 2881, 2933, 2960, 3096, 3111, 3196, 3558, 3877], 'studied': [58, 298, 1276], 'for': [59, 133, 183, 203, 299, 373, 423, 443, 750, 1277, 1490, 1888, 1907, 1983, 2039, 2134, 2178, 2214, 2337, 2551, 2787, 2883, 2901, 3046, 3113, 3155, 3560, 4035, 4073, 4085, 4105, 4116, 4126, 4138], 'their': [60, 86, 300, 326, 1278, 3836, 3845], 'ability': [61, 301, 1279, 4040], 'enhance': [63, 303], 'or': [64, 304, 1946, 2152, 2391, 2892, 3101, 3132, 3829, 4063], 'inhibit': [65, 107, 305, 347, 2475, 2503, 2534, 2572, 2712, 3385, 4045], 'this': [66, 159, 306, 399, 1647, 2679, 2768, 2878, 2942, 3087, 3091, 3150, 3314, 3331, 3987, 3993], 'reaction.': [69, 309, 3161, 3308, 3388], 'None': [70, 310], 'synthetic': [73, 313, 1064, 1181, 1748, 2319, 2466, 2607, 3169], 'was': [75, 131, 160, 315, 371, 400, 740, 1402, 1624, 1649, 1680, 1733, 1775, 1789, 1811, 1881, 1904, 1959, 1965, 1994, 2003, 2086, 2132, 2304, 2419, 2516, 2569, 2593, 2813, 2824, 2833, 2853, 2869, 2948, 3152, 3353, 3391, 3601, 3990], 'able': [76, 316, 2420, 2473, 3392], 'confer': [78, 318], 'protease-resistance': [79, 319], 'labeled': [82, 322, 2346, 2729], 'molecules': [84, 324, 2348, 2745, 3702], 'on': [85, 325, 1310, 1316, 1325, 2077, 2323, 2339, 2512], 'own.': [87, 327], 'On': [88, 328], 'contrary,': [90, 330], 'from': [92, 101, 121, 332, 341, 361, 603, 1265, 1293, 1404, 1626, 1682, 2287, 2598, 2610, 2753, 2767, 2782, 3185, 3266, 3297, 3362, 3374, 3554, 3582], 'central': [94, 334, 1295, 1327, 2600, 3187, 3235, 3436, 3484], 'part': [95, 335, 1328, 1992, 3188, 3485], 'hamster': [98, 338, 509, 1272, 1369, 1643, 1725, 1749, 1785, 2326, 2467, 2524, 2538, 3295, 3899, 3902], 'sequence': [100, 125, 196, 206, 340, 365, 436, 446, 796, 822, 1274, 2328, 2665, 2688, 2752, 2785, 3265, 3296, 3315, 3581, 4083], '106': [102, 342], '141': [104, 344, 3586], 'could': [105, 345, 3074, 3629, 3710], 'completely': [106, 346, 826], 'induced': [110, 350, 3220], 'preformed': [112, 352], 'PrPres.': [113, 353, 1352, 2350, 2893], 'presence': [115, 355, 1945, 2153, 2439, 2806, 3100, 3291, 3548], 'residues': [117, 217, 357, 457, 2781, 2812, 2843, 3339, 3553, 3567, 3583, 4022], '119': [118, 358, 3340], 'and': [119, 359, 524, 529, 537, 584, 616, 745, 785, 800, 816, 901, 906, 915, 1039, 1050, 1057, 1340, 1376, 1383, 1423, 1430, 1531, 1554, 1574, 1634, 1692, 1802, 1989, 2026, 2037, 2073, 2101, 2162, 2186, 2192, 2197, 2212, 2385, 2456, 2470, 2490, 2499, 2548, 2555, 2584, 2670, 2683, 2703, 2800, 2862, 2875, 2923, 2977, 2982, 3016, 3106, 3108, 3139, 3194, 3230, 3320, 3336, 3341, 3371, 3373, 3381, 3419, 3442, 3470, 3611, 3697, 3729, 3851, 3862, 4008, 4118, 4129, 4135], '120': [120, 360, 2614, 2756, 3300, 3342, 3557], 'highly': [123, 363, 2621], 'hydrophobic': [124, 364, 2680, 2751, 2778, 2811, 2840, 3059], 'AGAAAAGA': [126, 366, 2609, 2664, 2784], '(position': [127, 367], '113': [128, 368, 2612, 2754, 3298, 3555], '120)': [130, 370], 'crucial': [132, 372, 710], 'an': [134, 374, 587, 1192, 1997, 2563, 2695, 3323, 3590], 'efficient': [135, 375, 786, 3198], 'inhibitory': [136, 145, 376, 385, 1308, 2523, 2763, 2827, 2873, 3002, 3049, 3128, 3324, 3427, 3604, 3683, 3690, 3824], 'effect.': [137, 377], 'Fourier': [138, 378, 2221, 2849, 2894], 'transform': [139, 379, 2222, 2850, 2895], 'infrared': [140, 380, 2223, 2851, 2896], 'spectroscopy': [141, 381, 2224, 2852], 'analysis': [142, 382, 1384, 2196, 4078], 'indicated': [143, 383, 2155], 'that': [144, 166, 216, 235, 384, 406, 456, 475, 743, 909, 1044, 1333, 2590, 2932, 3177, 3225, 3258, 3467, 3622, 3657, 3896], 'formed': [147, 387, 602, 2967, 4010], 'high': [148, 388, 793, 1077, 1302, 1386, 2937, 3008, 3035, 3402, 3733], 'β-sheet': [149, 389, 614, 1080, 1303, 2938, 2994, 3009, 3021, 3038, 3734, 3849], 'aggregates': [150, 176, 390, 416, 621, 3853], 'under': [151, 391, 1286], 'conditions': [153, 393], 'reaction,': [157, 397, 2791], 'but': [158, 180, 398, 420, 3023, 3043, 3563], 'also': [161, 201, 401, 441, 3570], 'true': [162, 402], 'certain': [164, 404, 1067], 'not': [168, 181, 408, 421, 2127, 3044, 3153, 3272, 3329, 3384, 3833], 'inhibitory.': [169, 409], 'Thus,': [170, 410, 2749, 3029, 3143, 3992], 'potential': [172, 412, 3031], 'form': [174, 414, 1073, 1652, 2432, 3033, 3831, 3848], 'β-sheeted': [175, 415], 'may': [177, 417, 3178, 3232, 3995, 4031], 'necessary,': [179, 419, 3042], 'sufficient,': [182, 422, 3045], 'act': [186, 426], 'as': [187, 427, 1342, 1438, 1813, 1996, 2105, 2269, 2376, 2618, 2826, 2828, 2838, 2965, 3014, 3317, 3351, 3355, 3357, 3367, 3379, 3860], 'inhibitors': [188, 428], 'formation.': [191, 239, 431, 479, 3459, 3676], 'Clearly,': [192, 432], 'amino': [194, 434, 2779, 2841, 3551, 3565, 4020], 'acid': [195, 435, 1633, 2780, 2842, 3552, 3566, 4021], 'peptide': [199, 439, 1751, 2288, 2510, 2530, 2608, 2623, 2687, 2709, 3428, 3903, 4082], 'is': [200, 211, 440, 451, 601, 701, 2329, 3271, 3411, 3422, 3462, 3615, 3667, 3685, 3826, 3832], 'important': [202, 442, 3591, 3668], 'inhibition.': [204, 444], 'specificity': [207, 447], 'inhibition': [210, 450, 2818, 3026, 3070, 3157, 3214, 3304, 3350, 3596, 4086], 'consistent': [212, 452, 3463, 3616], 'idea': [215, 455], 'vicinity': [220, 460], 'positions': [222, 462], '106–141': [223, 463], 'and/or': [226, 466], 'critically': [229, 469], 'involved': [230, 470, 3180, 3451, 3573], 'intermolecular': [233, 473, 3454, 3577, 3671], 'interactions': [234, 474, 1047, 3227, 3455, 3672], 'lead': [236, 476, 4090], 'Transmissible': [480], '(TSE)': [483], '1The': [484], 'abbreviations': [485], 'used': [486, 1645, 2354, 2720, 2854, 3167], 'are:': [487], 'TSE,': [488], 'encephalopathies;': [491], 'PrP,': [492], 'protein;': [494, 498, 502], 'PrPsen,': [495, 3855], 'PrPres,': [499, 2735, 3418, 3439], 'Aβ-(1–40),': [503, 2568, 3017], 'amyloid-β': [504, 1397], 'fragment': [506, 1399], '1–40;': [507], 'HaPrPsen,': [508], 'PrPsen;': [510], 'PAGE,': [511], 'polyacrylamide': [512], 'gel': [513], 'electrophoresis;': [514], 'PK,': [515, 4002], 'proteinase': [516, 589, 1970, 3276], 'K.': [517, 1200, 1234, 1704, 3495, 3916, 3951], 'fatal': [519], 'neurodegenerative': [520], 'diseases': [521], 'including': [522], 'sporadic': [523], 'familial': [525], 'Creutzfeldt-Jakob': [526], 'disease,': [527], 'kuru': [528], 'Gerstmann-Sträussler-Scheinker': [530], 'syndrome': [531], 'humans,': [533], 'scrapie': [534, 1726], 'sheep,': [536], 'bovine': [538], 'encephalopathy': [540], 'cattle': [542], '(1Caughey': [543], 'B.': [544, 546, 680, 835, 839, 851, 881, 887, 927, 931, 958, 975, 1025, 1474, 1663, 1669, 1755, 1823, 1829, 1868, 3509, 3644, 3798], 'Chesebro': [545, 838, 850, 880, 926, 1662, 1822, 3643], 'Trends': [547], 'Cell': [548], 'Biol.': [549, 668, 1251, 3786, 3968], '1997;': [550, 988, 1027, 1252, 1476, 1870, 3969], '7:': [551, 572], '56-62Abstract': [552], 'Full': [553, 673, 3536, 3791], 'Text': [554, 674, 3537, 3792], 'PDF': [555, 675, 3538, 3793], 'PubMed': [556, 654, 676, 695, 775, 845, 857, 892, 942, 963, 991, 1030, 1109, 1130, 1153, 1174, 1229, 1255, 1479, 1609, 1674, 1712, 1767, 1834, 1873, 2653, 3254, 3503, 3539, 3650, 3772, 3794, 3813, 3945, 3972], 'Scopus': [557, 574, 655, 696, 776, 893, 943, 964, 992, 1031, 1110, 1131, 1154, 1175, 1230, 1256, 1480, 1675, 1713, 1835, 1874, 2654, 3504, 3540, 3773, 3814, 3946, 3973], '(170)': [558], 'Google': [559, 576, 657, 677, 698, 778, 846, 858, 895, 945, 966, 994, 1033, 1112, 1133, 1156, 1177, 1232, 1258, 1482, 1610, 1677, 1715, 1768, 1837, 1876, 2656, 3255, 3506, 3542, 3651, 3775, 3795, 3816, 3948, 3975], 'Scholar,': [560, 658, 678, 847, 946, 967, 995, 1113, 1134, 1157, 1838, 3507, 3776, 3796, 3949], '2Prusiner': [561], 'S.B.': [562, 643, 1098, 1218, 1248, 2642, 3517, 3529, 3761, 3934, 3965], 'Telling': [563], 'G.': [564, 1136, 1702, 3493], 'Cohen': [565, 640, 1093, 1213, 1243, 2637, 3758, 3929, 3960], 'F.E.': [566, 641, 1094, 1214, 1244, 2638, 3759, 3930, 3961], 'DeArmond': [567], 'S.J.': [568], 'Semin.': [569], 'Virol.': [570, 841, 853, 1605, 1763, 3250, 3646], '1996;': [571, 772, 1171], '159-173Crossref': [573], '(33)': [575], 'Scholar).': [577, 699, 779, 859, 896, 1034, 1178, 1259, 1483, 1611, 1678, 1716, 1769, 1877, 2657, 3543, 3652, 3817, 3976], 'TSE': [578, 911, 1058, 4074], 'formation': [583, 618, 829, 1056, 2477, 3908], 'accumulation': [585, 788, 3632, 4047], 'abnormal': [588], 'K-resistant': [590, 3277], 'normal': [594], 'host-encoded': [596], '(PrPsen).': [599], 'post-translational': [607], 'involving': [609], 'conformational': [610], 'changes,': [611], 'higher': [613], 'content,': [615, 3010], 'macromolecular': [620], '(3Pan': [622, 3740], 'K.-M.': [623, 1204, 3741, 3920], 'Baldwin': [624, 1085, 1215, 1245, 2629, 3742, 3931, 3962], 'M.': [625, 629, 760, 1084, 1144, 1595, 2628, 3513, 3743, 3747], 'Nguyen': [626, 3744], 'J.': [627, 660, 667, 840, 852, 999, 1009, 1159, 1249, 1448, 1458, 1604, 1696, 1708, 1762, 1842, 1852, 3249, 3487, 3499, 3645, 3745, 3778, 3785, 3966], 'Gasset': [628, 3746], 'Serban': [630, 3748], 'A.': [631, 650, 682, 762, 770, 938, 969, 987, 1007, 1105, 1126, 1165, 1225, 1456, 1850, 2649, 3248, 3749, 3768, 3800, 3941, 4124], 'Groth': [632, 3750], 'D.': [633, 686, 1202, 1759, 3511, 3751, 3804, 3918], 'Mehlhorn': [634, 3752], 'I.': [635, 1238, 3753, 3955], 'Huang': [636, 3754], 'Z.': [637, 3755], 'Fletterick': [638, 1095, 2639, 3756], 'R.J.': [639, 1588, 3757], 'Prusiner': [642, 1097, 1217, 1247, 2641, 3528, 3760, 3933, 3964], 'Proc.': [644, 932, 981, 1099, 1120, 1219, 2643, 3762, 3935], 'Natl.': [645, 933, 982, 1100, 1121, 1220, 2644, 3763, 3936], 'Acad.': [646, 934, 983, 1101, 1122, 1221, 2645, 3764, 3937], 'Sci.': [647, 935, 984, 1102, 1123, 1222, 2646, 3765, 3938], 'U.': [648, 936, 985, 1103, 1124, 1223, 2647, 3766, 3939], 'S.': [649, 754, 756, 766, 937, 954, 986, 1104, 1125, 1224, 2648, 3767, 3940], '1993;': [651, 670, 1127, 1150, 3769, 3788], '90:': [652, 1128, 3770], '10962-10966Crossref': [653, 3771], '(2084)': [656, 3774], '4Safar': [659, 3777], 'Roller': [661, 3779], 'P.P.': [662, 3780], 'Gadjusek': [663, 3781], 'D.C.': [664, 3782], 'Gibbs': [665, 3783], 'C.J.': [666, 3784], 'Chem.': [669, 3787], '268:': [671, 3789], '20276-20284Abstract': [672, 3790], '5Caughey': [679, 3797], 'Dong': [681, 3799], 'Bhat': [683, 3801], 'K.S.': [684, 3802], 'Ernst': [685, 1758, 3803], 'Hayes': [687, 3805], 'S.F.': [688, 3806], 'Caughey': [689, 834, 886, 930, 957, 974, 1024, 1473, 1668, 1828, 1867, 3807], 'W.S.': [690, 3808], 'Biochemistry.': [691, 3809], '1991;': [692, 1764, 3810], '30:': [693, 3811], '7672-7680Crossref': [694, 3812], '(744)': [697, 3815], 'closely': [702], 'TSE-mediated': [705], 'brain': [706, 727], 'pathology,': [707], 'suggesting': [708], 'role': [711, 3593], 'pathogenic': [716], 'process.': [717, 3707], 'However,': [718, 2464, 2830, 3835], 'absence': [721, 1947, 2151, 2400, 2733, 3102, 3122], 'expression': [724, 3280], 'tissue': [728], 'recipients': [730], 'scrapie-infected': [732, 806, 1685, 3282], 'neurografts,': [733], 'no': [734, 2403, 2990, 3025, 3980], 'pathology': [735, 752], 'outside': [736], 'graft': [738], 'itself': [739, 2422], 'observed,': [741], 'demonstrating': [742], 'both': [748, 2668], 'required': [749, 2532, 2786, 3559, 4084], '(6Brandner': [753], 'Isenmann': [755], 'Raeber': [757], 'A.J.': [758], 'Fischer': [759], 'Sailer': [761], 'Kobayashi': [763], 'Y.': [764], 'Marino': [765], 'Weissmann': [767, 3530], 'C.': [768, 3244, 3531], 'Aguzzi': [769], 'Nature.': [771, 888, 959, 1026, 1149, 1475, 1670, 1830, 1869], '379:': [773], '339-343Crossref': [774], '(721)': [777], 'Both': [780], 'cross-species': [781], 'transmission': [782], 'vivo': [784, 919, 1038, 4051], 'require': [791], 'degree': [794, 1078], 'homology': [797], 'between': [798, 899, 1048, 1338, 2091, 2872, 3228], 'molecules.': [802], 'For': [803, 2877, 2940, 3090], 'example,': [804], 'neuroblastoma': [807, 3284, 3638], 'cells,': [808], 'point': [809, 3624], 'mutations': [810], 'at': [811, 1413, 1425, 1493, 1579, 1636, 1777, 1804, 1891, 1910, 1986, 2042, 2137, 2175, 2181, 2217, 2360, 2578, 2715, 2904, 2929, 2945, 2961, 2996, 3400, 3626], 'three': [812, 2792], 'positions,': [813], '108,': [814], '111,': [815], '138,': [817], 'mouse': [820, 3261, 3283, 3637], 'sufficient': [824, 2814, 3154], 'block': [827, 3630, 3704], '(7Priola': [832], 'S.A.': [833, 849, 879, 923, 1003, 1452, 1661, 1821, 1846, 3642], 'Race': [836, 1760], 'R.E.': [837, 1761], '1994;': [842, 889, 1671, 1831], '68:': [843], '4873-4878Crossref': [844], '8Priola': [848], '1995;': [854, 939, 960, 1226, 3647, 3942], '69:': [855, 3648], '7754-7758Crossref': [856, 3649], 'system,': [865], 'induces': [867], '(9Kocisko': [874, 1656, 1816], 'D.A.': [875, 921, 950, 1001, 1450, 1657, 1817, 1844], 'Come': [876, 1658, 1818], 'J.H.': [877, 1115, 1659, 1819], 'Priola': [878, 922, 1002, 1451, 1660, 1820, 1845, 4125], 'Raymond': [882, 924, 951, 972, 1004, 1442, 1453, 1664, 1756, 1824, 1847], 'G.J.': [883, 925, 952, 973, 997, 1446, 1665, 1757, 1825, 1840], 'Lansbury': [884, 928, 955, 1022, 1118, 1471, 1666, 1826, 1865], 'P.T.': [885, 929, 956, 1023, 1119, 1472, 1667, 1827, 1866], '370:': [890, 1672, 1832], '471-474Crossref': [891, 1673, 1833], '(792)': [894, 1676, 1836], 'This': [897, 3460, 3613], 'interaction': [898, 3717], 'occurs': [903], 'species': [905, 912], 'strain': [907, 916, 1727], 'specificities': [908], 'mimic': [910, 3692], 'barrier': [913], 'effects': [914, 2338], 'differences': [917], '(10Kocisko': [920], '92:': [940, 1227, 3943], '3923-3927Crossref': [941], '(328)': [944], '11Bessen': [947], 'R.A.': [948, 3521], 'Kocisko': [949, 1000, 1449, 1843], 'Nandan': [953], '375:': [961], '698-700Crossref': [962], '(461)': [965], '12Bossers': [968], 'Belt': [970], 'P.B.G.': [971], 'de': [976], 'Vries': [977], 'R.': [978, 1019, 1096, 1140, 1210, 1468, 1590, 1597, 1862, 2640, 3519, 3926], 'Smits': [979, 1020, 1469, 1863], 'M.A.': [980, 1021, 1086, 1216, 1246, 1470, 1864, 2630, 3932, 3963], '94:': [989], '4931-4936Crossref': [990], '(160)': [993], '13Raymond': [996, 1839], 'Hope': [998, 1447, 1841], 'L.D.': [1005, 1454, 1848], 'Bossers': [1006, 1455, 1849], 'Ironside': [1008, 1457, 1851], 'Will': [1010, 1459, 1853], 'R.G.': [1011, 1460, 1854], 'Chen': [1012, 1461, 1855], 'S.G.': [1013, 1462, 1856], 'Petersen': [1014, 1463, 1857], 'R.B.': [1015, 1464, 1858], 'Gambetti': [1016, 1465, 1859], 'P.': [1017, 1466, 1860, 3523], 'Rubenstein': [1018, 1467, 1589, 1861], '388:': [1028, 1477, 1871], '285-288Crossref': [1029, 1478, 1872], '(239)': [1032, 1481, 1875], 'Collectively,': [1035], 'these': [1036, 1317, 2738, 2810, 3654], 'vitroobservations': [1041], 'strongly': [1042], 'suggest': [1043, 3656, 4032], 'precise': [1045], 'direct': [1046, 4061], 'critical': [1053, 3347, 4139], 'pathogenesis.': [1059], 'previous': [1061, 3619], 'small': [1063], 'containing': [1066, 1539, 1798], 'sequences': [1069], 'spontaneously': [1070], 'aggregated': [1071, 1193, 3830], 'fibrils': [1074], 'secondary': [1081], 'structure': [1082, 1363, 3039, 3694, 3850], '(14Gasset': [1083, 2627], 'Llyod': [1087, 2631], 'D.H.': [1088, 2632], 'Gabriel': [1089, 2633], 'J-M.': [1090, 2634], 'Holtzman': [1091, 2635], 'D.M.': [1092, 2636], '1992;': [1106, 2650], '89:': [1107, 2651], '10940-10944Crossref': [1108, 2652], '(316)': [1111, 2655], '15Come': [1114], 'Fraser': [1116], 'P.E.': [1117], '5959-5963Crossref': [1129], '(355)': [1132], '16Forloni': [1135], 'Angeretti': [1137], 'N.': [1138], 'Chiesa': [1139], 'Monzani': [1141], 'E.': [1142], 'Salmona': [1143], 'Bugiani': [1145], 'O.': [1146], 'Tagliavini': [1147], 'F.': [1148], '362:': [1151], '543-546Crossref': [1152], '(896)': [1155], '17Hope': [1158], 'Shearman': [1160], 'M.S.': [1161], 'Baxter': [1162], 'H.C.': [1163], 'Chong': [1164], 'Kelly': [1166], 'S.M.': [1167], 'Price': [1168], 'N.C.': [1169], 'Neurodegeneration.': [1170], '5:': [1172, 1710, 3501], '1-11Crossref': [1173], '(65)': [1176], 'Moreover,': [1179], 'other': [1180, 2492, 2973, 3011, 3564, 3892], 'interact': [1187], 'molecules,': [1190], 'forming': [1191], 'complex': [1194, 3914, 3989, 3994], 'increased': [1196], 'protease': [1197], 'resistance': [1198, 2742, 3882], '(18Kaneko': [1199, 3915], 'Peretz': [1201, 3917], 'Pan': [1203, 3919], 'Blochberger': [1205, 3921], 'T.C.': [1206, 3922], 'Wille': [1207, 1235, 3923, 3952], 'H.': [1208, 1236, 1240, 1242, 1603, 3246, 3924, 3953, 3957, 3959], 'Gabizon': [1209, 3925], 'Griffith': [1211, 3927], 'O.H.': [1212, 3928], '11160-11164Crossref': [1228, 3944], '(117)': [1231, 3947], 'Scholar,19Kaneko': [1233], 'Mehlorn': [1237, 3954], 'Zhang': [1239, 3956], 'Ball': [1241, 3958], 'Mol.': [1250, 3967], '270:': [1253, 3970], '574-586Crossref': [1254, 3971], '(48)': [1257, 3974], 'current': [1262, 3288], 'study,': [1263], 'variety': [1267], 'locations': [1269], 'influence': [1281, 2661], 'generation': [1283], 'conditions.': [1288], 'A': [1289, 2300, 2482, 2702, 2723, 3335, 3610], 'group': [1290], 'portion': [1296, 2601, 3437], 'molecule': [1300, 1332, 3176, 3448], 'having': [1301, 3313], 'content': [1304, 3022, 3735], 'displayed': [1305, 3864], 'strong': [1307], 'effect': [1309, 2508, 2764], 'assay.': [1314], 'Based': [1315], 'results,': [1318], 'we': [1319, 2672, 3066, 3166], 'propose': [1320], 'existence': [1322], 'sites': [1324], 'allow': [1334, 2816], 'specific': [1336, 3048, 3226, 3576, 4070], 'binding': [1337, 1617], 'first': [1344], 'step': [1345], 'following': [1354], 'synthesized': [1357, 2673, 2797], 'laboratory': [1360], 'molecular': [1362, 2097, 2381, 2452, 3984], 'NIAID,': [1365], 'NIH,': [1366], 'Rockville': [1367], 'MD:': [1368], 'P106–128': [1370], '(KTNMKHMAGAAAAGAVVGGLGGY),': [1371], 'P109–141': [1372], '(MKHMAGAAAAGAVVGGLGGYMLGSAMSRPMMHF),': [1373], 'P113–141': [1374], '(AGAAAAGAVVGGLGGYMLGSAMSRPMMHF),': [1375], 'P121–141': [1377], '(VVGGLGGYMLGSAMSRPMMHF).': [1378], 'Peptides': [1379, 3184, 3361], '>95%': [1381], 'pure,': [1382], 'pressure': [1387], 'liquid': [1388], 'chromatography': [1389], 'revealed': [1390], 'only': [1391, 2677], 'single': [1393], 'peak.': [1394], "Alzheimer's": [1395, 2567], 'disease': [1396], '1–40': [1400], '(Aβ-(1–40))': [1401], 'purchased': [1403], 'Sigma.': [1405], 'Lyophilized': [1406], 'dissolved': [1409], 'deionized': [1411], 'water': [1412, 2254, 2301, 2310], 'concentration': [1415, 2114, 2363, 2511, 2906, 3403], '2': [1417, 2527, 2559, 2908], 'mm,': [1418], 'distributed': [1419], '20-μl': [1421], 'aliquots,': [1422], 'stored': [1424, 1635, 1803], '−20': [1426, 1805], '°C.': [1427, 1806, 1893], 'radiolabeling': [1429], 'purification': [1432, 4119], '35S-PrPsen': [1435, 1918, 2104, 3884], 'performed': [1437, 1812], 'described': [1439, 1654, 1814, 2617], 'previously': [1440, 1655, 1815], 'et': [1443], 'al.': [1444, 3242], '(13Raymond': [1445], 'Briefly,': [1484, 1878], '90%': [1485], 'confluent': [1486], 'cells': [1487, 1515, 2234], 'cultured': [1489], '30': [1491, 2384, 2549], 'min': [1492, 1890, 2041, 2180], '37': [1494, 1892, 1911, 1987, 2138], '°C': [1495, 1581, 1638, 1912, 2139], '1.5': [1497, 1534], 'ml': [1498, 1535], 'methionine/cysteine-deficient': [1500], 'medium': [1501], 'followed': [1502], '90–120-min': [1505], 'incubation': [1506, 1578, 1955, 2169, 3125, 3897], '1.4': [1508], 'mCi': [1509], '[35S]methionine/cysteine/25-cm2': [1511], 'flask.': [1512], 'Then': [1513], 'washed': [1517], 'twice': [1518], 'phosphate-buffered': [1520, 1796], 'saline': [1521, 1797], '(20': [1522], 'mm': [1523, 1529, 1541, 1546, 1549, 1932, 1981, 2019, 2054, 2909, 3406], 'sodium': [1524, 1552, 1933], 'phosphate,': [1525], 'pH': [1526, 1543, 1935, 1978, 2056], '7.4,': [1527, 1544], '130': [1528, 1980], 'NaCl)': [1530, 1982], 'lysed': [1532], 'lysis': [1537, 1691], 'buffer': [1538, 1930, 1975, 2052, 2211, 2888], '5': [1540, 1548, 1566, 1937, 2033, 2071], 'Tris-HCl,': [1542, 2055], '140': [1545], 'NaCl,': [1547], 'EDTA,': [1550], '0.5%': [1551, 1555, 2067], 'deoxycholate,': [1553], 'Triton': [1556], 'X-100.': [1557], 'proteins': [1559], 'precipitated': [1561, 2031], 'addition': [1564, 2007], 'volumes': [1567, 2034], 'methanol,': [1569], 'resuspended': [1570, 2049], 'detergent-lipid': [1572], 'complexes,': [1573], 'immunoprecipitated': [1575], 'overnight': [1577], '4': [1580, 1637, 2015, 2062], 'anti-PrP': [1583], '3F4': [1584], 'monoclonal': [1585], 'antibody': [1586], '(20Kascsak': [1587], 'Merz': [1591], 'P.A.': [1592], 'Tonna': [1593], 'deMasi': [1594], 'Fersko': [1596], 'Carp': [1598], 'R.I.': [1599], 'Wisniewski': [1600], 'H.M.': [1601], 'Diringer': [1602], '1987;': [1606], '61:': [1607], '3688-3693Crossref': [1608], 'Immune': [1612], 'complexes': [1613], 'collected': [1615, 2191, 2259], 'A-Sepharose': [1620], 'beads.': [1621], 'Radiolabeled': [1622], 'eluted': [1625], 'Sepharose': [1627], 'beads': [1628], 'using': [1629, 1738, 2519, 4029], '0.1': [1630], 'm': [1631, 2063, 2145], 'acetic': [1632], 'until': [1639], 'use.': [1640], '35S-labeled': [1642, 2447], 'study': [1648], 'glycophosphatidylinositol-negative': [1651], '(35S-HaPrPsen)': [1653], 'purified': [1681, 1879], 'brains': [1683], 'Syrian': [1686], 'golden': [1687], 'hamsters': [1688], 'detergent': [1690], 'differential': [1693], 'centrifugation': [1694], '(21Hope': [1695, 3486], 'Morton': [1697, 3488], 'L.J.D.': [1698, 3489], 'Farquhar': [1699, 3490], 'C.F.': [1700, 3491], 'Multhaup': [1701, 3492], 'Beyreuther': [1703, 3494], 'Kimberlin': [1705, 3496], 'R.H.': [1706, 3497], 'EMBO': [1707, 3498], '1986;': [1709, 3500], '2591-2597Crossref': [1711, 3502], '(261)': [1714, 3505], 'Hamsters': [1717], 'infected': [1719], '70': [1720], 'days': [1721], 'before': [1722, 2194, 2220], '263K.': [1728], 'yield': [1730], 'determined': [1734], 'Western': [1736], 'blotting': [1737], 'rabbit': [1740], 'polyclonal': [1741], 'antiserum': [1743], '(R27)': [1744], 'raised': [1745], 'against': [1746], '(residues': [1752], '89–103)': [1753], '(22Caughey': [1754], '65:': [1765], '6597-6603Crossref': [1766], 'purity': [1771], 'preparations': [1774], 'estimated': [1776], '50–60%': [1778], 'silver-staining': [1780], 'SDS-PAGE': [1782, 2076, 2195], 'gels.': [1783, 2080], 'preparation': [1787, 4109], '(HaPrPres)': [1788], 'then': [1790, 1905, 2030, 2305], 'diluted': [1791], '1': [1793, 1984, 2275, 2333, 2371, 2460, 3408, 3886], 'mg/ml': [1794, 2016], '1%': [1799], 'sulfobetaine': [1800], '3–14': [1801], 'reaction': [1810, 1958, 2002, 2541, 3094, 3723], 'partially': [1882, 2486, 2793, 2963], 'denatured': [1883], '2.5': [1885, 2144], 'mguanidine': [1886], 'hydrochloride': [1887], '30–60': [1889], 'An': [1894], 'aliquot': [1895], '200': [1897, 2141, 2441], 'ng': [1898, 1915, 2142, 2442], 'HaPrPres,': [1900, 2402, 2444], 'typically': [1901], '8': [1902], 'μl,': [1903], 'incubated': [1906, 2133, 2213, 2726, 2882, 2900, 3399], '40': [1908, 2699], 'h': [1909, 1985, 2136, 2216, 2885, 2903], '~1': [1914], 'immunopurified': [1917], '(~12,000': [1919], 'cpm/reaction)': [1920, 2131], 'final': [1923, 2362], 'volume': [1924], '20': [1926, 2018, 2040, 2179, 2457], 'μl': [1927, 2010], '(50': [1931, 1976], 'citrate,': [1934], '6,': [1936], 'mmcetylpyridinium': [1938], 'chloride,': [1939], '0.625%': [1940], 'N-lauryl': [1941], 'sarcosinate)': [1942], 'peptides.': [1949], 'At': [1950, 2112, 2164], 'end': [1952, 2166], 'time,': [1956, 2170], 'each': [1957, 2023, 2966], 'split': [1960], '1:10,': [1961], 'major': [1963], 'fraction': [1964, 2024], 'digested': [1966], '100': [1968], 'μg/ml': [1969], 'K': [1971], '(PK)': [1972], 'Tris-saline': [1974], 'mmTris,': [1977], '8,': [1979], '°C,': [1988], 'minor': [1991], '(−PK)': [1993], 'reserved': [1995], 'undigested': [1998], 'control.': [1999], 'PK': [2001, 2122, 2741, 3480, 3881, 3978, 4026], 'stopped': [2004], '10': [2009], 'mixture': [2013], 'thyroglobulin,': [2017], 'Pefabloc': [2020], '(Boehringer-Mannheim)': [2021], '(+': [2025], '−PK).': [2027], 'Samples': [2028, 2226], 'methanol': [2036], 'centrifuged': [2038, 2174, 3097], '14,000': [2043, 2182], '×': [2044], 'g.': [2045], 'pellets': [2047, 2188], 'sample': [2051, 2249], '(65': [2053], '6.8,': [2057], '5%': [2058, 2060, 2065], 'glycerol,': [2059], 'SDS,': [2061], 'urea,': [2064], 'β-mercaptoethanol,': [2066], 'bromphenol': [2068], 'blue),': [2069], 'boiled': [2070], 'min,': [2072], 'analyzed': [2074, 3112], 'NOVEX': [2078], 'pre-cast': [2079], 'percent': [2082], 'calculated': [2087, 2544], 'ratio': [2090], 'PK-resistant35S-labeled': [2093], 'bands': [2094, 2312, 2405, 2448], 'approximate': [2096], 'masses': [2098, 2382, 2453], '28–30': [2099], 'kDa': [2100, 2458], 'nondigested': [2103], 'quantified': [2106], 'phosphor': [2108, 2198], 'autoradiographic': [2109, 2199], 'imager': [2110, 2200], 'analysis.': [2111, 2225], 'used,': [2115], 'none': [2116, 2415, 2736, 3872], 'affected': [2120], 'digestion': [2123, 3481], '(data': [2126], 'shown).': [2128], 'Immunopurified35S-HaPrPsen': [2129], '(12,000': [2130], '24': [2135, 2455, 2902], 'guanidine': [2146], 'hydrochloride-pretreated': [2147], 'HaPrPres': [2148], 'concentrations': [2156, 2531, 2580, 2719, 2952], 'P-(109–141),': [2159, 2471, 2556, 2671, 2920, 2941, 3193, 3728], 'P-(113–141),': [2160, 2921, 3195], 'P-(121–141),': [2161, 2922], 'Aβ-(1–40).': [2163], 'samples': [2172], 'room': [2176, 2218], 'temperature': [2177, 2219], '×g.': [2183], 'supernatants': [2185], 'separately': [2190], 'methanol-precipitated': [2193], 'quantification.': [2201], 'dried': [2203], 'rehydrated': [2206], 'mixing': [2208], '4–60': [2215, 2884], '(6': [2227], 'μl)': [2228], 'loaded': [2230], 'variable': [2232], 'path-length': [2233], 'CaF2': [2236], 'plates': [2237], 'adjusted': [2238], 'path': [2241, 2278], 'length': [2242], '6': [2244], 'μm.': [2245], 'After': [2246], 'purging': [2247], 'chamber': [2250], 'reduce': [2252], 'vapor': [2255, 2302, 2311], 'contribution,': [2256], 'spectra': [2257, 2284, 2289, 2897], 'Perkin-Elmer': [2262], 'system': [2263, 3640], '2000': [2264], 'spectrometer.': [2265], 'Spectral': [2266], 'parameters': [2267], 'follows:': [2270], '254': [2271], 'scans;': [2272], '4-cm−1': [2273], 'resolution;': [2274], 'cm/sec': [2276], 'optical': [2277], 'difference': [2279], 'velocity;': [2280], 'Kaiser-Bessel': [2281], 'apodization.': [2282], 'Buffer': [2283], 'subtracted': [2286, 2306], 'give': [2291], 'flat': [2293], 'base': [2294], 'line': [2295], '1800–2200-cm−1': [2298], 'region.': [2299, 2316], 'spectrum': [2303], 'minimize': [2308], '1750–1850-cm−1': [2315], 'Various': [2317], 'peptides,': [2320, 2468, 2493, 3012, 3105, 3124, 4121], 'whose': [2321], 'localization': [2322], 'primary': [2325], 'Fig.': [2332, 2370, 2802, 2913], 'A,': [2334], 'tested': [2336, 2581, 3875], 'metabolically': [2345], 'assay': [2359, 3219], '0.8': [2365, 3405], 'mm.': [2366, 2955], 'As': [2367], 'B,': [2372, 2434], 'non-PK-treated35S-HaPrPsen': [2374], 'appeared': [2375, 2757, 3343], 'double': [2378], 'band': [2379], '28.5': [2386], 'kDa,': [2387], 'corresponding': [2388, 3294], 'mono-': [2390], 'unglycosylated': [2392], 'forms': [2393], 'molecule,': [2396], 'respectively.': [2397], 'PK-resistant': [2404, 2431, 2446, 2479, 3415], 'seen': [2407], 'control': [2410], 'experiment.': [2411], 'those': [2413], 'conditions,': [2414, 3891], 'promote': [2424], '35S-HaPrPsen': [2428, 3114, 3117], '(Fig.1': [2433], 'lanesmarked': [2435], '−).': [2436], 'two': [2445, 2465, 2521, 2674, 2808], 'obtained': [2450], '(Fig.': [2459, 2526, 2558, 2746, 2846, 3407, 3885], 'B,lanes': [2461], 'marked': [2462], '+).': [2463], 'P-(106–128)': [2469, 2554, 2669, 3600], 'of35S-labeled': [2478], 'bands.': [2481], 'third': [2483], 'peptide,': [2484, 2566], 'P-(89–103),': [2485], 'inhibited': [2487, 2595, 2690], 'conversion,': [2489, 3598], 'six': [2491], 'P-(23–37),': [2494, 3368], 'P-(57–64),': [2495, 3369], 'P-(57–72),': [2496, 3370], 'P-(57–80),': [2497], 'P-(139–170),': [2498], 'P-(218–232)': [2500, 3382], 'failed': [2501, 2710], 'conversion.': [2505, 3028], 'quantitative': [2507], 'examined': [2517], 'further': [2518, 3716], 'most': [2522, 2620, 3346, 3426], 'A).': [2528, 2748], '50%': [2535], '(IC50)': [2542], '230': [2547, 3211], 'μm': [2550, 2700, 3207], 'respectively': [2557], 'B).': [2560, 2585, 2704, 2804, 2848, 3337, 3360, 3409, 3612, 3887], 'contrast,': [2562, 2706], 'unrelated': [2564], 'amyloidogenic': [2565, 2622], 'unable': [2570], 'all': [2579, 2716, 3000, 3310], '(Figs.': [2582, 2721, 3333, 3608], '2,A': [2583], 'These': [2586, 2956, 3430], 'results': [2587, 3655], 'clearly': [2588], 'demonstrated': [2589], 'specifically': [2594], 'molecule.': [2604, 3239], 'position': [2611, 3627], 'To': [2658, 2772], 'assess': [2659], 'contained': [2666, 3412], 'differing': [2676], 'sequence,': [2681, 3191], 'P-(113–141)': [2682, 2686, 3321, 3358, 3730], 'P-(121–141).': [2684], 'efficiently': [2689], 'vitroconversion': [2693], 'IC50': [2696, 2832, 3209], 'value': [2697], '(Figs.3,': [2701], 'P-(121–141)': [2708, 3015, 3327, 3861], '3,': [2722, 3334], 'andB).': [2724], 'When': [2725], 'conferred': [2740], '3': [2747, 2803, 2847], 'essential': [2760], 'region': [2769, 3236, 3365, 3377, 3659], 'PrP.': [2771], 'find': [2773], 'minimal': [2775, 4081], 'number': [2776], 'inhibiting': [2788, 3200], 'deleted': [2794], '(P-(119–141),': [2798], 'P-(117–141),': [2799], 'P-(115–141),': [2801], 'because': [2822], 'P-(119–141)': [2823, 3352], 'nearly': [2825, 3354], 'P-(113–141).': [2829], 'decreased': [2834], 'up': [2835], '3-fold': [2837], 'additional': [2839], 'added': [2845], 'compare': [2856], 'conformations': [2858], 'Aβ-(1–40)': [2863, 3863], 'see': [2866], 'if': [2867], 'there': [2868], 'correlation': [2871], 'efficacy': [2874], 'conformation.': [2876], 'purpose,': [2879, 3092], 'without': [2889], 'any': [2890, 3052], '4.': [2914], 'Five': [2915], '(P-(106–128),': [2919], 'Aβ-(1–40))': [2924, 3136], 'showed': [2925, 3004, 3018, 3257], 'prominent': [2926], 'absorbance': [2927, 2944, 2984, 2995], 'maxima': [2928, 2985], '~1630': [2930, 2997], 'cm−1': [2931, 2947], 'indicative': [2934], 'content.': [2939], 'predominant': [2943], '1630': [2946], 'maintained': [2949, 2979], 'down': [2950], '0.2': [2954], 'same': [2957, 3866], 'five': [2958], 'least': [2962], 'insoluble': [2964], 'visible': [2969], 'particulate': [2970], 'suspension.': [2971], 'Two': [2972], '(P-(89–103)': [2976], 'P-(218–232))': [2978], 'clear': [2980], 'solutions': [2981], 'had': [2983, 3322], 'near': [2986], '1667': [2987], 'cm−1,': [2988], 'evidence': [2991, 3005], 'cm−1.': [2998], 'Although': [2999], 'such': [3013, 3222, 3316, 3366, 3378, 3859], 'similar': [3020], 'gave': [3024], 'amount': [3036], 'might': [3040, 3083, 4068, 4089], 'activity': [3050], 'given': [3053], 'peptide.': [3054], 'Considering': [3055], 'propensity': [3057], 'aggregate': [3063, 3999], 'vitro,': [3065], 'investigated': [3067], 'whether': [3068], 'explained': [3076, 3842], 'peptide-induced': [3078, 3145], 'aggregation': [3079, 3138, 3146], '35S-HaPrPsen,': [3081], 'which': [3082, 4016], 'prevent': [3084], 'precursor': [3088], 'protein.': [3089], 'mixtures': [3095], 'pellet': [3107], 'supernatant': [3109], 'fractions': [3110], '(Fig.5).': [3115], 'Whereas': [3116], 'remained': [3118], 'soluble': [3119, 3828], 'either': [3127], '(P-(109–141),': [3130], 'P-(113–141))': [3131], 'noninhibitory': [3133, 3857], '(P-(121–141),': [3135], 'caused': [3137], 'pelleting': [3140], '35S-HaPrPsen.': [3142], 'although': [3144], 'occurred,': [3149], 'sedimentation': [3151], 'report,': [3165], 'map': [3172], 'portions': [3173, 3472], 'PrPres-PrPsen': [3182], 'interactions.': [3183], 'P-(106–128),': [3192, 3318, 3727], 'very': [3197], '(30': [3206], '<': [3208, 3210], 'μm).': [3212], 'suggests': [3224], 'involve': [3233], 'Ho¨lscheret': [3241], '(23Ho¨lscher': [3243], 'Delius': [3245], 'Bürckle': [3247], '1998;': [3251], '72:': [3252], '1153-1159Crossref': [3253], 'Scholar)': [3256], 'mutant': [3260], 'lacking': [3263], '114': [3267], '121': [3269], '(AGAAAAGA)': [3270], 'converted': [3273], 'after': [3279], 'cells.': [3285], 'our': [3287, 3545, 3870, 4012], 'studies,': [3289], 'correlated': [3301], 'Indeed,': [3309], 'P-(109–1410,': [3319], 'effect,': [3325], 'whereas': [3326], 'did': [3328, 3383], 'exhibit': [3330], 'property': [3332], 'Interestingly,': [3338], 'effective': [3356], '(Fig.3': [3359], 'amino-terminal': [3364, 3471, 4019], 'P-(57–80)': [3372], 'carboxyl-terminal': [3376, 3444], 'P-(139–170)': [3380], 'Only': [3389], 'P-(89–103)': [3390, 3410], 'slightly': [3394, 3889], 'decrease': [3395], 'when': [3398], 'core': [3416], 'its': [3420], 'location': [3421], 'adjacent': [3423, 3580], 'sequences.': [3429], 'data': [3431], 'suggested': [3432], 'that,': [3433], 'unlike': [3434], 'amino-': [3441], 'regions': [3445], 'less': [3450, 3603], 'resulting': [3456], 'explanation': [3461], 'fact': [3466], 'carboxyl-': [3469], 'more': [3476], 'sensitive': [3477], 'than': [3482], '24Oesch': [3508], 'Westaway': [3510], 'Walchli': [3512], 'McKinley': [3514], 'M.P.': [3515], 'Kent': [3516], 'Aebersold': [3518], 'Barry': [3520], 'Tempst': [3522], 'Teplow': [3524], 'D.B.': [3525], 'Hood': [3526], 'L.E.': [3527], 'Cell.': [3532], '1985;': [3533], '40:': [3534], '735-746Abstract': [3535], '(1253)': [3541], 'maximal': [3561], 'inhibition,': [3562], 'likely': [3569], 'interaction.': [3578], '129': [3584], 'seemed': [3587], 'play': [3589], 'modulatory': [3592], 'since': [3599, 3856], 'significantly': [3602], 'compared': [3605], 'P-(109–141)': [3607], '2,': [3609], 'interpretation': [3614], 'report': [3620], 'showing': [3621], 'mutation': [3625], '138': [3628, 3662], 'cell': [3639], '(8Priola': [3641], 'Together': [3653], 'residue': [3661], 'polypeptide': [3666], 'leading': [3673], 'mechanism': [3678, 3837], 'action': [3680, 3839], 'still': [3686], 'unclear.': [3687], 'Possibly': [3688], 'competitively': [3698], 'bind': [3699, 3711], 'Alternatively,': [3708], 'itself,': [3714], 'blocking': [3715], 'PrPsen.': [3719], 'buffer,': [3724], 'possessed': [3731], 'reminiscent': [3736], 'brain-derived': [3738, 4006], 'Whether': [3818], 'active': [3820], 'state': [3821], 'known.': [3834], 'cannot': [3840], 'merely': [3843], 'tendency': [3846], 'sedimentable': [3852, 3912], 'biochemical': [3867], 'properties.': [3868], 'hands,': [3871], 'conferring': [3880], 'Using': [3888], 'different': [3890], 'authors': [3893], 'have': [3894], 'P-(90–145)': [3904], 'resulted': [3905], 'PK-resistant,': [3911], 'PrPsen·peptide': [3913, 3988], '19Kaneko': [3950], 'Upon': [3977], 'digestion,': [3979], 'shift': [3981], 'mass': [3985], 'reported.': [3991], 'large': [3998], 'unaccessible': [4000], 'contrast': [4004], 'loses': [4017], '~67': [4018], '(6–7': [4023], 'kDa)': [4024], 'treatment.': [4027], 'Studies': [4028], 'new': [4033], 'approaches': [4034], 'possible': [4036], 'therapeutic': [4037, 4071, 4097], 'intervention.': [4038], 'remains': [4052], 'established.': [4055], 'Nevertheless,': [4056], 'dispensed': [4059], 'injection': [4062], 'delivered': [4064], 'gene': [4066], 'therapy': [4067], 'provide': [4069], 'treatment': [4072], 'diseases.': [4075], 'Furthermore,': [4076], 'structural': [4077], 'development': [4092], 'nonpeptide': [4094], 'compounds': [4095], 'potential.': [4098], 'We': [4099], 'wish': [4100], 'thank': [4102], 'Gary': [4103], 'Hettrick': [4104], 'help': [4106], 'figures,': [4112], 'Dr.': [4113, 4122], 'Jan': [4114], 'Lukszo': [4115], 'synthesis': [4117], 'Suzette': [4123], 'stimulating': [4127], 'discussions,': [4128], 'Drs.': [4130], 'Heidi': [4131], 'Super,': [4132], 'Jim': [4133], 'Fox,': [4134], 'Kim': [4136], 'Hasenkrug': [4137], 'reading': [4140], 'manuscript.': [4143]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2016415814', 'counts_by_year': [{'year': 2023, 'cited_by_count': 1}, {'year': 2021, 'cited_by_count': 4}, {'year': 2020, 'cited_by_count': 3}, {'year': 2019, 'cited_by_count': 1}, {'year': 2018, 'cited_by_count': 2}, {'year': 2017, 'cited_by_count': 7}, {'year': 2016, 'cited_by_count': 1}, {'year': 2015, 'cited_by_count': 6}, {'year': 2014, 'cited_by_count': 5}, {'year': 2013, 'cited_by_count': 6}, {'year': 2012, 'cited_by_count': 6}], 'updated_date': '2024-12-12T04:40:46.734674', 'created_date': '2016-06-24'}