Publication Information

{'id': 'https://openalex.org/W2001547524', 'doi': 'https://doi.org/10.1002/pssa.2210300205', 'title': 'Strain rate sensitivity and the portevin-le chatelier effect in Au–Cu alloys', 'display_name': 'Strain rate sensitivity and the portevin-le chatelier effect in Au–Cu alloys', 'publication_year': 1975, 'publication_date': '1975-08-16', 'ids': {'openalex': 'https://openalex.org/W2001547524', 'doi': 'https://doi.org/10.1002/pssa.2210300205', 'mag': '2001547524'}, 'language': 'en', 'primary_location': {'is_oa': False, 'landing_page_url': 'https://doi.org/10.1002/pssa.2210300205', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4210228582', 'display_name': 'physica status solidi (a)', 'issn_l': '0031-8965', 'issn': ['0031-8965', '1521-396X'], 'is_oa': False, 'is_in_doaj': False, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320595', 'host_organization_name': 'Wiley', 'host_organization_lineage': ['https://openalex.org/P4310320595'], 'host_organization_lineage_names': ['Wiley'], 'type': 'journal'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref'], 'open_access': {'is_oa': False, 'oa_status': 'closed', 'oa_url': None, 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5080561101', 'display_name': 'S.H. van den Brink', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I98358874', 'display_name': 'Delft University of Technology', 'ror': 'https://ror.org/02e2c7k09', 'country_code': 'NL', 'type': 'education', 'lineage': ['https://openalex.org/I98358874']}], 'countries': ['NL'], 'is_corresponding': False, 'raw_author_name': 'S. H. van den Brink', 'raw_affiliation_strings': ['Laboratorium voor Metaalkunde, Technische Hogeschool Delft, The Netherlands'], 'affiliations': [{'raw_affiliation_string': 'Laboratorium voor Metaalkunde, Technische Hogeschool Delft, The Netherlands', 'institution_ids': ['https://openalex.org/I98358874']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5072797523', 'display_name': 'A. van den Beukel', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I98358874', 'display_name': 'Delft University of Technology', 'ror': 'https://ror.org/02e2c7k09', 'country_code': 'NL', 'type': 'education', 'lineage': ['https://openalex.org/I98358874']}], 'countries': ['NL'], 'is_corresponding': False, 'raw_author_name': 'A. van den Beukel', 'raw_affiliation_strings': ['Laboratorium voor Metaalkunde, Technische Hogeschool Delft, The Netherlands'], 'affiliations': [{'raw_affiliation_string': 'Laboratorium voor Metaalkunde, Technische Hogeschool Delft, The Netherlands', 'institution_ids': ['https://openalex.org/I98358874']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5113635763', 'display_name': 'P.G. McCormick', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I31746571', 'display_name': 'UNSW Sydney', 'ror': 'https://ror.org/03r8z3t63', 'country_code': 'AU', 'type': 'education', 'lineage': ['https://openalex.org/I31746571']}], 'countries': ['AU'], 'is_corresponding': False, 'raw_author_name': 'P. G. McCormick', 'raw_affiliation_strings': ['School of Metallurgy, University of New South Wales, Kensington, N.S.W. Australia'], 'affiliations': [{'raw_affiliation_string': 'School of Metallurgy, University of New South Wales, Kensington, N.S.W. Australia', 'institution_ids': ['https://openalex.org/I31746571']}]}], 'institution_assertions': [], 'countries_distinct_count': 2, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': None, 'apc_paid': None, 'fwci': 1.065, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 108, 'citation_normalized_percentile': {'value': 0.978063, 'is_in_top_1_percent': False, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 97, 'max': 98}, 'biblio': {'volume': '30', 'issue': '2', 'first_page': '469', 'last_page': '477'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T10204', 'display_name': 'Microstructure and mechanical properties', 'score': 0.9992, 'subfield': {'id': 'https://openalex.org/subfields/2505', 'display_name': 'Materials Chemistry'}, 'field': {'id': 'https://openalex.org/fields/25', 'display_name': 'Materials Science'}, 'domain': {'id': 'https://openalex.org/domains/3', 'display_name': 'Physical Sciences'}}, 'topics': [{'id': 'https://openalex.org/T10204', 'display_name': 'Microstructure and mechanical properties', 'score': 0.9992, 'subfield': {'id': 'https://openalex.org/subfields/2505', 'display_name': 'Materials Chemistry'}, 'field': {'id': 'https://openalex.org/fields/25', 'display_name': 'Materials Science'}, 'domain': {'id': 'https://openalex.org/domains/3', 'display_name': 'Physical Sciences'}}, {'id': 'https://openalex.org/T11201', 'display_name': 'Metallurgy and Material Forming', 'score': 0.999, 'subfield': {'id': 'https://openalex.org/subfields/2211', 'display_name': 'Mechanics of Materials'}, 'field': {'id': 'https://openalex.org/fields/22', 'display_name': 'Engineering'}, 'domain': {'id': 'https://openalex.org/domains/3', 'display_name': 'Physical Sciences'}}, {'id': 'https://openalex.org/T12099', 'display_name': 'Advanced materials and composites', 'score': 0.996, 'subfield': {'id': 'https://openalex.org/subfields/2210', 'display_name': 'Mechanical Engineering'}, 'field': {'id': 'https://openalex.org/fields/22', 'display_name': 'Engineering'}, 'domain': {'id': 'https://openalex.org/domains/3', 'display_name': 'Physical Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/flow-stress', 'display_name': 'Flow stress', 'score': 0.6976433}, {'id': 'https://openalex.org/keywords/strain', 'display_name': 'Strain (injury)', 'score': 0.47678828}], 'concepts': [{'id': 'https://openalex.org/C162611839', 'wikidata': 'https://www.wikidata.org/wiki/Q912214', 'display_name': 'Flow stress', 'level': 3, 'score': 0.6976433}, {'id': 'https://openalex.org/C149342994', 'wikidata': 'https://www.wikidata.org/wiki/Q3181055', 'display_name': 'Strain rate', 'level': 2, 'score': 0.6879451}, {'id': 'https://openalex.org/C2778022156', 'wikidata': 'https://www.wikidata.org/wiki/Q576145', 'display_name': 'Strain (injury)', 'level': 2, 'score': 0.47678828}, {'id': 'https://openalex.org/C117087868', 'wikidata': 'https://www.wikidata.org/wiki/Q5319024', 'display_name': 'Dynamic strain aging', 'level': 3, 'score': 0.45771873}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.39525342}, {'id': 'https://openalex.org/C113196181', 'wikidata': 'https://www.wikidata.org/wiki/Q485223', 'display_name': 'Analytical Chemistry (journal)', 'level': 2, 'score': 0.35185832}, {'id': 'https://openalex.org/C192562407', 'wikidata': 'https://www.wikidata.org/wiki/Q228736', 'display_name': 'Materials science', 'level': 0, 'score': 0.34462264}, {'id': 'https://openalex.org/C97355855', 'wikidata': 'https://www.wikidata.org/wiki/Q11473', 'display_name': 'Thermodynamics', 'level': 1, 'score': 0.3426884}, {'id': 'https://openalex.org/C191897082', 'wikidata': 'https://www.wikidata.org/wiki/Q11467', 'display_name': 'Metallurgy', 'level': 1, 'score': 0.3023225}, {'id': 'https://openalex.org/C121332964', 'wikidata': 'https://www.wikidata.org/wiki/Q413', 'display_name': 'Physics', 'level': 0, 'score': 0.25648138}, {'id': 'https://openalex.org/C43617362', 'wikidata': 'https://www.wikidata.org/wiki/Q170050', 'display_name': 'Chromatography', 'level': 1, 'score': 0.039393604}, {'id': 'https://openalex.org/C71924100', 'wikidata': 'https://www.wikidata.org/wiki/Q11190', 'display_name': 'Medicine', 'level': 0, 'score': 0.0}, {'id': 'https://openalex.org/C126322002', 'wikidata': 'https://www.wikidata.org/wiki/Q11180', 'display_name': 'Internal medicine', 'level': 1, 'score': 0.0}], 'mesh': [], 'locations_count': 1, 'locations': [{'is_oa': False, 'landing_page_url': 'https://doi.org/10.1002/pssa.2210300205', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4210228582', 'display_name': 'physica status solidi (a)', 'issn_l': '0031-8965', 'issn': ['0031-8965', '1521-396X'], 'is_oa': False, 'is_in_doaj': False, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320595', 'host_organization_name': 'Wiley', 'host_organization_lineage': ['https://openalex.org/P4310320595'], 'host_organization_lineage_names': ['Wiley'], 'type': 'journal'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': None, 'sustainable_development_goals': [], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 15, 'referenced_works': ['https://openalex.org/W1963924089', 'https://openalex.org/W1966834206', 'https://openalex.org/W1987380917', 'https://openalex.org/W1994598542', 'https://openalex.org/W2001469540', 'https://openalex.org/W2007139430', 'https://openalex.org/W2019237780', 'https://openalex.org/W2032987589', 'https://openalex.org/W2040577827', 'https://openalex.org/W2048342308', 'https://openalex.org/W2059058827', 'https://openalex.org/W2060977542', 'https://openalex.org/W2089818386', 'https://openalex.org/W2091687265', 'https://openalex.org/W2496653730'], 'related_works': ['https://openalex.org/W4200265249', 'https://openalex.org/W2958985340', 'https://openalex.org/W2744433168', 'https://openalex.org/W2500493914', 'https://openalex.org/W2375536475', 'https://openalex.org/W2362212451', 'https://openalex.org/W2336385494', 'https://openalex.org/W2159581289', 'https://openalex.org/W2070254195', 'https://openalex.org/W2000044286'], 'abstract_inverted_index': {'physica': [0], 'status': [1], 'solidi': [2], '(a)Volume': [3], '30,': [4, 551], 'Issue': [5], '2': [6, 483], 'p.': [7], '469-477': [8, 703], 'Original': [9], 'Paper': [10], 'Strain': [11], 'rate': [12, 232, 292, 296, 352], 'sensitivity': [13, 297], 'and': [14, 180, 184, 196, 203, 222, 270, 487, 508, 523, 566, 585, 602, 619, 634, 656, 681], 'the': [15, 198, 208, 235, 242, 248, 282, 294, 299, 305, 310, 313, 334], 'portevin-le': [16], 'chatelier': [17], 'effect': [18, 229, 288, 306], 'in': [19, 241, 322], 'Au–Cu': [20, 239], 'alloys': [21, 240], 'S.': [22, 27, 89, 94, 484, 509, 629], 'H.': [23, 28, 90, 95, 620, 630, 645], 'van': [24, 29, 46, 50, 91, 96, 113, 117, 544, 588, 604, 631], 'den': [25, 30, 47, 51, 92, 97, 114, 118, 465, 545, 605, 632, 693], 'Brink,': [26, 93], 'Brink': [31, 98, 633], 'Laboratorium': [32, 53, 99, 120], 'voor': [33, 54, 100, 121], 'Metaalkunde,': [34, 55, 101, 122], 'Technische': [35, 56, 102, 123], 'Hogeschool': [36, 57, 103, 124], 'Delft,': [37, 58, 104, 125], 'The': [38, 59, 105, 126, 228, 256, 287, 318, 343], 'NetherlandsSearch': [39, 60, 106, 127], 'for': [40, 61, 83, 107, 128, 150, 328], 'more': [41, 62, 84, 108, 129, 151], 'papers': [42, 63, 85, 109, 130, 152], 'by': [43, 64, 86, 110, 131, 153], 'this': [44, 65, 87, 111, 132, 154, 217], 'authorA.': [45, 112], 'Beukel,': [48, 115, 546, 606], 'A.': [49, 116, 475, 488, 506, 521, 524, 543, 583, 596, 600, 603, 644], 'Beukel': [52, 119], 'authorP.': [66, 133], 'G.': [67, 70, 134, 137, 535, 613, 636, 691], 'McCormick,': [68, 135, 536, 637], 'P.': [69, 136, 498, 534, 635, 678], 'McCormick': [71, 138], 'School': [72, 139], 'of': [73, 76, 140, 143, 182, 192, 205, 216, 230, 238, 244, 250, 258, 274, 284, 289, 298, 307, 315, 324, 336, 345, 579, 671], 'Metallurgy,': [74, 141], 'University': [75, 142, 578, 670], 'New': [77, 144], 'South': [78, 145], 'Wales,': [79, 146], 'Kensington,': [80, 147], 'N.S.W.': [81, 148], 'AustraliaSearch': [82, 149], 'author': [88, 155], 'First': [156], 'published:': [157], '16': [158, 652], 'August': [159, 701], '1975': [160], 'https://doi.org/10.1002/pssa.2210300205Citations:': [161], '105AboutPDF': [162], 'ToolsRequest': [163], 'permissionExport': [164], 'citationAdd': [165], 'to': [166, 188, 211, 247, 263, 281, 339], 'favoritesTrack': [167], 'citation': [168], 'ShareShare': [169], 'Give': [170], 'accessShare': [171, 174], 'full': [172], 'text': [173], 'full-text': [175, 190, 214], 'accessPlease': [176], 'review': [177], 'our': [178], 'Terms': [179, 202], 'Conditions': [181, 204], 'Use': [183], 'check': [185], 'box': [186], 'below': [187, 210], 'share': [189, 212], 'version': [191, 215], 'article.I': [193], 'have': [194], 'read': [195], 'accept': [197], 'Wiley': [199], 'Online': [200], 'Library': [201], 'UseShareable': [206], 'LinkUse': [207], 'link': [209], 'a': [213, 325], 'article': [218], 'with': [219, 304], 'your': [220], 'friends': [221], 'colleagues.': [223], 'Learn': [224], 'more.Copy': [225], 'URL': [226], 'Abstracten': [227], 'strain': [231, 245, 267, 291, 295, 311, 330, 351], 'changes': [233, 353], 'on': [234, 265, 293, 309, 333], 'flow': [236, 300, 347], 'stress': [237, 301, 348], 'region': [243], 'prior': [246, 280], 'start': [249], 'serrated': [251, 285, 316], 'yielding': [252], 'has': [253], 'been': [254], 'investigated.': [255, 356], 'measurements': [257], 'Δσ/Δ': [259, 260, 275, 383, 384, 403], 'were': [261, 278], 'found': [262], 'depend': [264], 'strain,': [266], 'rate,': [268], 'temperature,': [269], 'composition.': [271], 'Negative': [272], 'values': [273], 'ln': [276, 404], 'ϵ': [277, 308, 405, 421], 'observed': [279], 'onset': [283, 314], 'yielding.': [286, 317], 'base': [290], 'was': [302, 354], 'correlated': [303], 'at': [312], 'results': [319], 'are': [320], 'interpreted': [321], 'terms': [323], 'recent': [326], 'model': [327], 'dynamic': [329], 'ageing': [331], 'based': [332], 'diffusion': [335], 'solute': [337], 'atoms': [338], 'temporarily': [340], 'arrested': [341], 'dislocations.': [342], 'occurrence': [344], 'pronounced': [346], 'transients': [349], 'accompanying': [350], 'also': [355], 'Abstractde': [357], 'Der': [358, 407], 'Einfluß': [359, 408, 419], 'der': [360, 362, 386, 409, 414, 444, 461, 467], 'Änderung': [361], 'Deformationsgeschwindigkeit': [363, 410, 468], 'auf': [364, 411, 422, 443], 'die': [365, 412, 423], 'Fließspanung': [366], 'von': [367, 385, 402, 420, 446, 458], 'Au–Cu-Legierungen': [368], 'im': [369], 'Deformationsbereich': [370], 'vor': [371], 'dem': [372, 394, 418], 'Einsatz': [373, 395], 'des': [374, 396, 427], 'stufenweisen': [375, 397, 428], 'Fließens': [376, 398, 429], 'wird': [377, 380, 416, 471], 'untersucht.': [378, 472], 'Es': [379], 'gefunden,': [381], 'daß': [382], 'Deformation,': [387], 'Deformationsgeschwindigkeit,': [388], 'Temperatur': [389], 'und': [390], 'Zusammensetzung': [391], 'abhängt.': [392], 'Vor': [393], 'werden': [399, 433], 'negative': [400], 'Werte': [401], 'beobachtet.': [406], 'Deformationsgeschwindigkeitsempfindlichkeit': [413], 'Fließspannung': [415], 'mit': [417, 434, 464], 'Deformation': [424], 'beim': [425], 'Einsetzen': [426], 'korreliert.': [430], 'Die': [431], 'Ergebnisse': [432], 'einem': [435], 'kürzlich': [436], 'veröffentlichten': [437], 'Modell': [438], 'für': [439], 'dynamische': [440], 'Deformationsalterung,': [441], 'das': [442, 456, 463], 'Diffusion': [445], 'gelösten': [447], 'Atomen': [448], 'zu': [449], 'zeitweise': [450], 'festgesetzten': [451], 'Versetzungen': [452], 'beruht,': [453], 'interpretiert.': [454], 'Auch': [455], 'Auftreten': [457], 'ausgeprägtem': [459], 'Einschwingverhalten': [460], 'Fließspannung,': [462], 'Änderungen': [466], 'verbunden': [469], 'ist,': [470], 'References': [473], '1': [474], 'W.': [476, 621], 'Sleeswijk,': [477], 'Acta': [478, 500, 537, 607, 623], 'metall.': [479, 501, 538, 591, 608, 624, 639], '6,': [480], '548': [481], '(1958).': [482], 'R.': [485, 510, 525, 653], 'Bodner': [486], 'Rosen,': [489], 'J.': [490, 512, 555, 586, 676, 679, 682, 692], 'Mech.': [491, 513], 'Phys.': [492, 514], 'Solids': [493, 515], '15,': [494, 516, 661], '63': [495], '(1967).': [496, 518, 663], '3': [497], 'Penning,': [499], '20,': [502, 539], '1169': [503], '(1972).': [504, 541], '4': [505], 'Rosen': [507], 'Bodner,': [511], '47': [517], '5': [519], 'B.': [520], 'Wilcox': [522], 'Rosenfield,': [526], 'Mater.': [527], 'Sci.': [528], 'Engng.': [529], '1,': [530], '201': [531], '(1966).': [532, 573], '6': [533], '351': [540], '7': [542], 'phys.': [547], 'stat.': [548], 'sol.': [549], '(a)': [550], '197': [552], '(1975).': [553], '8': [554], 'Friedel,': [556], 'Dislocations,': [557], 'Pergamon': [558], 'Press,': [559], '1964': [560], '(p.': [561], '405).': [562], '9': [563], 'D.': [564, 657, 675, 683], 'Munz': [565], 'E.': [567, 617], 'Macherauch,': [568], 'Z.': [569], 'Metallk.': [570], '57,': [571], '442': [572], '10': [574], 'L.': [575, 616], 'Gastberger,': [576], 'Dissertation,': [577], 'Karlsruhe,': [580], '1971.': [581], '11': [582], 'Wijler': [584], 'Schade': [587], 'Westrum,': [589], 'Scripta': [590, 638], '5,': [592], '531': [593], '(1971).': [594], '12': [595], 'Wijler,': [597], 'M.': [598, 599], 'Vrijhoef,': [601], '22,': [609], '13': [610, 612], '(1974).': [611, 642], 'F.': [614], 'Bolling,': [615], 'Hays,': [618], 'Wiedersich,': [622], '9,': [625], '622': [626], '(1961).': [627], '14': [628], '8,': [640], '1251': [641], '15': [643], 'Cottrell,': [646], 'Phil.': [647, 659, 685], 'Mag.': [648, 660, 686], '44,': [649], '829': [650], '(1953).': [651], 'K.': [654, 665], 'Ham': [655], 'Jaffrey,': [658], '247': [662], '17': [664], 'Smidt,': [666], 'Internal': [667], 'report,': [668], 'Delft': [669], 'Technology,': [672], '1974.': [673], '18': [674], 'Lloyd,': [677], 'Worthington,': [680], 'Embury,': [684], '21,': [687], '1147': [688], '(1970).': [689], '19': [690], 'Otter,': [694], 'private': [695], 'communication.': [696], 'Citing': [697], 'Literature': [698], 'Volume30,': [699], 'Issue216': [700], '1975Pages': [702], 'ReferencesRelatedInformation': [704]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2001547524', 'counts_by_year': [{'year': 2023, 'cited_by_count': 2}, {'year': 2022, 'cited_by_count': 6}, {'year': 2021, 'cited_by_count': 4}, {'year': 2020, 'cited_by_count': 1}, {'year': 2019, 'cited_by_count': 1}, {'year': 2018, 'cited_by_count': 2}, {'year': 2017, 'cited_by_count': 2}, {'year': 2016, 'cited_by_count': 2}, {'year': 2014, 'cited_by_count': 2}], 'updated_date': '2024-12-14T05:12:51.298811', 'created_date': '2016-06-24'}