Publication Information

{'id': 'https://openalex.org/W2000746761', 'doi': 'https://doi.org/10.1074/jbc.273.2.964', 'title': 'Water-soluble Nicotinic Acetylcholine Receptor Formed by α7 Subunit Extracellular Domains', 'display_name': 'Water-soluble Nicotinic Acetylcholine Receptor Formed by α7 Subunit Extracellular Domains', 'publication_year': 1998, 'publication_date': '1998-01-01', 'ids': {'openalex': 'https://openalex.org/W2000746761', 'doi': 'https://doi.org/10.1074/jbc.273.2.964', 'mag': '2000746761', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/9422757'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.273.2.964', 'pdf_url': 'http://www.jbc.org/article/S0021925818395644/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925818395644/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5047731505', 'display_name': 'Gregg B. Wells', 'orcid': 'https://orcid.org/0000-0002-1513-8323'}, 'institutions': [{'id': 'https://openalex.org/I79576946', 'display_name': 'University of Pennsylvania', 'ror': 'https://ror.org/00b30xv10', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I79576946']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Gregg B. Wells', 'raw_affiliation_strings': ['Department of Pathology and Laboratory Medicine, School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6082'], 'affiliations': [{'raw_affiliation_string': 'Department of Pathology and Laboratory Medicine, School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6082', 'institution_ids': ['https://openalex.org/I79576946']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5111517044', 'display_name': 'René Anand', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I2801463575', 'display_name': 'University Medical Center New Orleans', 'ror': 'https://ror.org/02zrb2v54', 'country_code': 'US', 'type': 'healthcare', 'lineage': ['https://openalex.org/I2801463575', 'https://openalex.org/I75420490']}, {'id': 'https://openalex.org/I121820613', 'display_name': 'Louisiana State University', 'ror': 'https://ror.org/05ect4e57', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I121820613']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'René Anand', 'raw_affiliation_strings': ['Neuroscience Center of Excellence and Department of Biochemistry and Molecular Biology, Louisiana State University Medical Center, New Orleans, Louisiana 70112'], 'affiliations': [{'raw_affiliation_string': 'Neuroscience Center of Excellence and Department of Biochemistry and Molecular Biology, Louisiana State University Medical Center, New Orleans, Louisiana 70112', 'institution_ids': ['https://openalex.org/I2801463575', 'https://openalex.org/I121820613']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5079553525', 'display_name': 'Fan Wang', 'orcid': 'https://orcid.org/0000-0002-1583-1419'}, 'institutions': [{'id': 'https://openalex.org/I79576946', 'display_name': 'University of Pennsylvania', 'ror': 'https://ror.org/00b30xv10', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I79576946']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Fan Wang', 'raw_affiliation_strings': ['Department of Neuroscience, School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6074'], 'affiliations': [{'raw_affiliation_string': 'Department of Neuroscience, School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6074', 'institution_ids': ['https://openalex.org/I79576946']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5111706975', 'display_name': 'Jon Lindstrom', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I79576946', 'display_name': 'University of Pennsylvania', 'ror': 'https://ror.org/00b30xv10', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I79576946']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Jon Lindstrom', 'raw_affiliation_strings': ['Department of Neuroscience, School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6074'], 'affiliations': [{'raw_affiliation_string': 'Department of Neuroscience, School of Medicine, University of Pennsylvania, Philadelphia, Pennsylvania 19104-6074', 'institution_ids': ['https://openalex.org/I79576946']}]}], 'institution_assertions': [], 'countries_distinct_count': 1, 'institutions_distinct_count': 3, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 1.956, 'has_fulltext': True, 'fulltext_origin': 'pdf', 'cited_by_count': 42, 'citation_normalized_percentile': {'value': 0.750754, 'is_in_top_1_percent': False, 'is_in_top_10_percent': False}, 'cited_by_percentile_year': {'min': 90, 'max': 91}, 'biblio': {'volume': '273', 'issue': '2', 'first_page': '964', 'last_page': '973'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T11818', 'display_name': 'Nicotinic Acetylcholine Receptors Study', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T11818', 'display_name': 'Nicotinic Acetylcholine Receptors Study', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T10493', 'display_name': 'Ion channel regulation and function', 'score': 0.9982, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11178', 'display_name': 'Receptor Mechanisms and Signaling', 'score': 0.9952, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/cys-loop-receptors', 'display_name': 'Cys-loop receptors', 'score': 0.5197265}, {'id': 'https://openalex.org/keywords/sedimentation-equilibrium', 'display_name': 'Sedimentation equilibrium', 'score': 0.48013398}], 'concepts': [{'id': 'https://openalex.org/C80161118', 'wikidata': 'https://www.wikidata.org/wiki/Q408520', 'display_name': 'Acetylcholine receptor', 'level': 3, 'score': 0.82788426}, {'id': 'https://openalex.org/C2779570518', 'wikidata': 'https://www.wikidata.org/wiki/Q412256', 'display_name': 'Nicotinic acetylcholine receptor', 'level': 4, 'score': 0.7745719}, {'id': 'https://openalex.org/C118892022', 'wikidata': 'https://www.wikidata.org/wiki/Q7834587', 'display_name': 'Transmembrane domain', 'level': 3, 'score': 0.7069372}, {'id': 'https://openalex.org/C185592680', 'wikidata': 'https://www.wikidata.org/wiki/Q2329', 'display_name': 'Chemistry', 'level': 0, 'score': 0.68511415}, {'id': 'https://openalex.org/C12554922', 'wikidata': 'https://www.wikidata.org/wiki/Q7100', 'display_name': 'Biophysics', 'level': 1, 'score': 0.6006492}, {'id': 'https://openalex.org/C188987157', 'wikidata': 'https://www.wikidata.org/wiki/Q7030581', 'display_name': 'Nicotinic agonist', 'level': 3, 'score': 0.59931684}, {'id': 'https://openalex.org/C28406088', 'wikidata': 'https://www.wikidata.org/wiki/Q5571762', 'display_name': 'Extracellular', 'level': 2, 'score': 0.59671175}, {'id': 'https://openalex.org/C24530287', 'wikidata': 'https://www.wikidata.org/wiki/Q424204', 'display_name': 'Transmembrane protein', 'level': 3, 'score': 0.5722842}, {'id': 'https://openalex.org/C116569031', 'wikidata': 'https://www.wikidata.org/wiki/Q899107', 'display_name': 'Ligand (biochemistry)', 'level': 3, 'score': 0.5687108}, {'id': 'https://openalex.org/C123419017', 'wikidata': 'https://www.wikidata.org/wiki/Q7826734', 'display_name': 'Torpedo', 'level': 4, 'score': 0.5446685}, {'id': 'https://openalex.org/C2775910092', 'wikidata': 'https://www.wikidata.org/wiki/Q180623', 'display_name': 'Acetylcholine', 'level': 2, 'score': 0.54396284}, {'id': 'https://openalex.org/C104292427', 'wikidata': 'https://www.wikidata.org/wiki/Q899781', 'display_name': 'Protein subunit', 'level': 3, 'score': 0.5422192}, {'id': 'https://openalex.org/C19876734', 'wikidata': 'https://www.wikidata.org/wiki/Q5201170', 'display_name': 'Cys-loop receptors', 'level': 5, 'score': 0.5197265}, {'id': 'https://openalex.org/C46749446', 'wikidata': 'https://www.wikidata.org/wiki/Q3047157', 'display_name': 'Sedimentation equilibrium', 'level': 3, 'score': 0.48013398}, {'id': 'https://openalex.org/C170493617', 'wikidata': 'https://www.wikidata.org/wiki/Q208467', 'display_name': 'Receptor', 'level': 2, 'score': 0.44163233}, {'id': 'https://openalex.org/C50254741', 'wikidata': 'https://www.wikidata.org/wiki/Q62536', 'display_name': 'Ion channel', 'level': 3, 'score': 0.4225186}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.34657395}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.18042597}, {'id': 'https://openalex.org/C98274493', 'wikidata': 'https://www.wikidata.org/wiki/Q128406', 'display_name': 'Pharmacology', 'level': 1, 'score': 0.08332294}, {'id': 'https://openalex.org/C181199279', 'wikidata': 'https://www.wikidata.org/wiki/Q8047', 'display_name': 'Enzyme', 'level': 2, 'score': 0.058452576}, {'id': 'https://openalex.org/C104317684', 'wikidata': 'https://www.wikidata.org/wiki/Q7187', 'display_name': 'Gene', 'level': 2, 'score': 0.0}], 'mesh': [{'descriptor_ui': 'D011978', 'descriptor_name': 'Receptors, Nicotinic', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D000109', 'descriptor_name': 'Acetylcholine', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000109', 'descriptor_name': 'Acetylcholine', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000818', 'descriptor_name': 'Animals', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002038', 'descriptor_name': 'Bungarotoxins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002038', 'descriptor_name': 'Bungarotoxins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D002645', 'descriptor_name': 'Chickens', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D007457', 'descriptor_name': 'Iodine Radioisotopes', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009538', 'descriptor_name': 'Nicotine', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D009538', 'descriptor_name': 'Nicotine', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D011485', 'descriptor_name': 'Protein Binding', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011869', 'descriptor_name': 'Radioligand Assay', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011978', 'descriptor_name': 'Receptors, Nicotinic', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011978', 'descriptor_name': 'Receptors, Nicotinic', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D011994', 'descriptor_name': 'Recombinant Proteins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D012995', 'descriptor_name': 'Solubility', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D014867', 'descriptor_name': 'Water', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.273.2.964', 'pdf_url': 'http://www.jbc.org/article/S0021925818395644/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/9422757', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.273.2.964', 'pdf_url': 'http://www.jbc.org/article/S0021925818395644/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [{'display_name': 'Clean water and sanitation', 'id': 'https://metadata.un.org/sdg/6', 'score': 0.71}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 70, 'referenced_works': ['https://openalex.org/W1487561672', 'https://openalex.org/W1555742321', 'https://openalex.org/W1575543707', 'https://openalex.org/W1580482299', 'https://openalex.org/W1596464958', 'https://openalex.org/W1744070583', 'https://openalex.org/W1971350452', 'https://openalex.org/W1972144556', 'https://openalex.org/W1972840804', 'https://openalex.org/W1976301256', 'https://openalex.org/W1984412128', 'https://openalex.org/W1985832876', 'https://openalex.org/W1985984620', 'https://openalex.org/W1987115674', 'https://openalex.org/W1987466586', 'https://openalex.org/W1987864496', 'https://openalex.org/W1996621120', 'https://openalex.org/W1997808465', 'https://openalex.org/W2000411253', 'https://openalex.org/W2005765265', 'https://openalex.org/W2006257052', 'https://openalex.org/W2011622844', 'https://openalex.org/W2012163065', 'https://openalex.org/W2013341464', 'https://openalex.org/W2013434392', 'https://openalex.org/W2014660497', 'https://openalex.org/W2014816521', 'https://openalex.org/W2015512183', 'https://openalex.org/W2018490550', 'https://openalex.org/W2022995022', 'https://openalex.org/W2023359966', 'https://openalex.org/W2025864476', 'https://openalex.org/W2029254143', 'https://openalex.org/W2031368977', 'https://openalex.org/W2038697935', 'https://openalex.org/W2038733372', 'https://openalex.org/W2039892336', 'https://openalex.org/W2047784037', 'https://openalex.org/W2049722290', 'https://openalex.org/W2050578006', 'https://openalex.org/W2052623014', 'https://openalex.org/W2052710242', 'https://openalex.org/W2052725697', 'https://openalex.org/W2053099934', 'https://openalex.org/W2055738243', 'https://openalex.org/W2057551724', 'https://openalex.org/W2059501084', 'https://openalex.org/W2060971156', 'https://openalex.org/W2062999041', 'https://openalex.org/W2065335184', 'https://openalex.org/W2067270959', 'https://openalex.org/W2070151592', 'https://openalex.org/W2074631079', 'https://openalex.org/W2075798487', 'https://openalex.org/W2078119356', 'https://openalex.org/W2078856564', 'https://openalex.org/W2080956086', 'https://openalex.org/W2081556250', 'https://openalex.org/W2082928276', 'https://openalex.org/W2090200045', 'https://openalex.org/W2092665603', 'https://openalex.org/W2095461202', 'https://openalex.org/W2103889969', 'https://openalex.org/W2141743775', 'https://openalex.org/W2161252280', 'https://openalex.org/W2175428614', 'https://openalex.org/W2213646474', 'https://openalex.org/W2411900406', 'https://openalex.org/W2413878775', 'https://openalex.org/W3008293697'], 'related_works': ['https://openalex.org/W81472463', 'https://openalex.org/W785279518', 'https://openalex.org/W42537826', 'https://openalex.org/W2142055365', 'https://openalex.org/W2135831304', 'https://openalex.org/W2072353469', 'https://openalex.org/W2046517694', 'https://openalex.org/W2005226742', 'https://openalex.org/W2000746761', 'https://openalex.org/W192634894'], 'abstract_inverted_index': {'Water-soluble': [0, 126], 'models': [1, 127, 1408], 'of': [2, 16, 19, 25, 29, 99, 118, 121, 128, 142, 145, 151, 155, 225, 244, 247, 345, 351, 353, 366, 369, 431, 461, 516, 531, 588, 615, 618, 625, 661, 673, 686, 757, 787, 794, 868, 872, 886, 977, 980, 1014, 1029, 1032, 1037, 1057, 1064, 1215, 1224, 1245, 1260, 1329, 1343, 1354, 1385, 1402, 1412, 1421, 1424, 1434, 1452, 1474, 1485, 1523, 1550, 1553, 1560, 1636, 1642, 1651, 1691, 1743, 1848, 1892, 1899, 1905, 1942, 1951, 2025, 2089, 2097, 2107, 2141, 2152, 2158, 2169, 2172, 2185, 2211, 2239, 2247, 2255, 2290, 2317, 2326, 2363, 2493, 2526, 2541, 2560, 2577, 2666, 2669, 2678, 2763, 2834, 2841, 2861, 2900, 2925, 2960, 2986, 2994, 3015, 3029, 3074, 3094, 3099, 3103, 3113, 3141, 3169, 3183, 3201, 3255, 3263, 3295, 3319, 3394, 3400, 3487, 3509, 3541, 3605, 3670, 3749, 3758, 3774, 3822, 3929, 3936, 3943, 3947, 3974, 4033, 4081, 4094, 4125, 4139, 4146, 4161, 4170, 4174, 4193, 4214, 4237, 4252, 4269, 4280, 4306, 4340, 4441, 4456, 4468, 4487, 4506, 4532, 4566, 4577, 4584, 4588, 4621], 'ligand-gated': [3, 129], 'ion': [4, 130, 327, 1554, 3978], 'channels': [5, 131, 328, 372], 'would': [6, 132], 'be': [7, 133, 1009, 1543, 1826, 1844, 2136, 4360, 4403], 'advantageous': [8, 134], 'for': [9, 36, 83, 135, 162, 209, 597, 997, 1062, 1390, 1409, 1547, 1676, 1778, 1781, 1791, 1846, 1889, 1915, 1964, 1976, 2003, 2017, 2075, 2131, 2221, 2270, 2333, 2466, 2487, 2588, 2657, 2793, 3013, 3177, 3196, 3274, 3362, 3415, 3528, 3563, 3843, 3847, 3885, 3918, 4069, 4114, 4289, 4328, 4384, 4415, 4490, 4495], 'structural': [10, 136, 894, 1012, 1407, 1548, 4287], 'studies.': [11, 137], 'We': [12, 138, 1463, 1497, 3321], 'investigated': [13, 139], 'the': [14, 20, 26, 30, 49, 67, 97, 106, 119, 122, 140, 146, 152, 156, 175, 193, 223, 232, 245, 248, 330, 343, 362, 436, 444, 585, 604, 610, 616, 619, 626, 633, 639, 655, 662, 687, 694, 699, 780, 788, 809, 869, 987, 1006, 1019, 1027, 1030, 1033, 1041, 1047, 1058, 1074, 1222, 1340, 1344, 1381, 1398, 1410, 1413, 1422, 1425, 1435, 1450, 1481, 1486, 1503, 1524, 1532, 1634, 1640, 1644, 1649, 1655, 1677, 1689, 1727, 1740, 1744, 1783, 1822, 1849, 1852, 1890, 1897, 1900, 1903, 1916, 1927, 1939, 1949, 1952, 1961, 1974, 2000, 2014, 2072, 2086, 2094, 2098, 2105, 2108, 2124, 2129, 2149, 2155, 2167, 2170, 2182, 2190, 2209, 2212, 2222, 2236, 2240, 2244, 2259, 2268, 2278, 2291, 2498, 2504, 2509, 2531, 2536, 2542, 2553, 2565, 2570, 2578, 2582, 2640, 2679, 2692, 2753, 2764, 2835, 2839, 2859, 2868, 2898, 2916, 2920, 2926, 2939, 2958, 2987, 2992, 3016, 3027, 3072, 3095, 3110, 3139, 3170, 3181, 3185, 3197, 3226, 3237, 3243, 3252, 3261, 3266, 3279, 3293, 3301, 3323, 3389, 3698, 3719, 3830, 3860, 3886, 3903, 3944, 3948, 3952, 3972, 4028, 4086, 4092, 4102, 4135, 4144, 4171, 4175, 4186, 4191, 4208, 4215, 4224, 4250, 4253, 4278, 4281, 4294, 4303, 4307, 4318, 4325, 4338, 4344, 4395, 4400, 4410, 4454, 4485, 4529, 4533, 4547, 4605, 4617, 4622], 'suitability': [15, 141], 'three': [17, 143, 658, 901, 2292, 2845, 2889, 3066, 3397, 3495, 3517, 3549, 3613, 3678, 4168, 4623], 'versions': [18, 47, 144, 173], 'N-terminal': [21, 147, 586, 640, 1953, 2199, 2241, 4187], 'extracellular': [22, 148, 269, 303, 641, 1954], 'domain': [23, 52, 70, 149, 178, 196, 642, 1955, 2200], '(ECD)': [24, 150, 643], 'α7': [27, 107, 124, 153, 233, 250, 789, 814, 1330, 1355, 1386, 1403, 1415, 1426, 1494, 1526, 1533, 1538, 1562, 1637, 1645, 1735, 1747, 2173, 2186, 3417, 3419, 3436, 3458, 3638, 3703, 4176, 4194, 4216, 4367], 'subunit': [28, 154, 437, 591, 691, 790, 1427, 1749, 1784, 2365, 2505, 2532, 2566, 4177, 4217], 'nicotinic': [31, 157, 261, 295], 'acetylcholine': [32, 158, 253, 262, 296, 346, 1066], 'receptor': [33, 159], '(AChR)': [34, 160], 'family': [35, 161, 365], 'this': [37, 163, 978, 1379, 1551, 2256, 2476, 2517, 2637, 3249], 'purpose': [38, 164, 3364], 'by': [39, 165, 536, 649, 1455, 1661, 1669, 1721, 1851, 2229, 2396, 2428, 2482, 2521, 2544, 2775, 3083, 3215, 3284, 3316, 3925, 3932, 3959, 4121, 4127, 4331, 4346, 4405, 4550, 4570], 'examining': [40, 166], 'their': [41, 79, 90, 167, 205, 216, 354], 'ligand-binding': [42, 168, 4417], 'and': [43, 53, 71, 86, 169, 179, 197, 212, 332, 358, 378, 442, 486, 500, 599, 602, 644, 671, 676, 684, 703, 705, 708, 717, 760, 796, 801, 943, 986, 1024, 1061, 1249, 1346, 1356, 1431, 1468, 1477, 1518, 1664, 1682, 1780, 1834, 1902, 1930, 2082, 2128, 2154, 2174, 2195, 2243, 2312, 2328, 2354, 2360, 2436, 2484, 2491, 2549, 2596, 2650, 2672, 2698, 2721, 2830, 2871, 2897, 2932, 2955, 2980, 3007, 3048, 3071, 3085, 3101, 3109, 3137, 3163, 3192, 3276, 3391, 3418, 3441, 3463, 3643, 3716, 3788, 3807, 3907, 3927, 3998, 4037, 4063, 4071, 4106, 4123, 4190, 4197, 4211, 4221, 4247, 4255, 4261, 4378, 4389, 4407, 4450, 4492, 4601, 4634], 'assembly': [44, 170, 1056, 1219, 1334], 'properties.': [45, 171], 'Two': [46, 172], 'included': [48, 174, 1447, 1819, 1879, 2121, 4323, 4393], 'first': [50, 68, 176, 194, 1341, 4182], 'transmembrane': [51, 69, 177, 195, 279, 313, 611, 628, 4381], 'were': [54, 94, 180, 220, 1446, 1973, 2013, 2120, 2146, 2275, 2394, 2519, 2655, 2785, 2819, 2887, 2922, 2946, 3064, 3128, 3145, 3213, 3282, 3492, 3514, 3546, 3610, 3675, 3705, 3741, 3762, 3797, 3832, 3905, 4104, 4178, 4392, 4479, 4498, 4517], 'solubilized': [55, 181, 3442, 3464, 3644, 3742, 3750], 'with': [56, 89, 96, 182, 215, 222, 342, 435, 468, 492, 970, 1253, 1428, 1444, 1512, 1828, 2101, 2322, 2367, 2375, 2433, 2440, 2607, 2618, 2647, 2663, 2757, 2787, 2821, 2851, 2891, 2973, 3024, 3068, 3106, 3153, 3187, 3190, 3697, 3840, 3909, 4004, 4030, 4108, 4283, 4448, 4556, 4573, 4632], 'detergent': [57, 183, 2477], 'after': [58, 184, 1831, 2022, 2929, 3092, 4351], 'expression': [59, 185, 1592, 2251, 4455], 'inXenopus': [60, 186], 'oocytes.': [61, 187, 1441, 2514], 'The': [62, 188, 529, 580, 1211, 1442, 1556, 1730, 1772, 1815, 1875, 2114, 2160, 2197, 2273, 2315, 2423, 2472, 2523, 2557, 2817, 2885, 2944, 3019, 3062, 3126, 3206, 3269, 3380, 3795, 3889, 3955, 4022, 4050, 4073, 4130, 4154, 4167, 4181, 4228, 4267, 4312, 4353, 4504, 4559, 4582, 4625], 'third': [63, 189, 2161, 4354], 'was': [64, 72, 190, 198, 1586, 1659, 1667, 1736, 1776, 1818, 1881, 1884, 1922, 2110, 2164, 2187, 2202, 2233, 2294, 2301, 2320, 2373, 2426, 2430, 2438, 2480, 2485, 2501, 2528, 2562, 2601, 2642, 2687, 2696, 2755, 2773, 2853, 2865, 2882, 2902, 2911, 2965, 2971, 2982, 3001, 3021, 3035, 3059, 3076, 3090, 3123, 3151, 3157, 3165, 3175, 3892, 3938, 3957, 4025, 4038, 4052, 4067, 4076, 4089, 4132, 4143, 4157, 4204, 4300, 4322, 4334, 4357, 4541, 4597], 'truncated': [65, 191, 2165, 4372, 4396], 'before': [66, 192, 2953, 3135, 4310, 4376, 4461, 4511, 4590], 'soluble': [73, 199, 2473, 2537, 4544], 'without': [74, 200, 1437, 1506, 2685, 3046, 4045, 4536], 'detergent.': [75, 201, 4095], 'For': [76, 202, 654, 784, 1630, 2358, 2496, 2828, 2858, 2915, 2990, 3026, 3815], 'all': [77, 203, 4521], 'three,': [78, 204], 'equilibrium': [80, 206, 3207, 3330], 'binding': [81, 207, 696, 782, 811, 1067, 1255, 1466, 1483, 1782, 2970, 3150, 3257, 3760, 3819, 3960, 4163], 'affinities': [82, 208, 1513, 3414], 'α-bungarotoxin,': [84, 210], 'nicotine,': [85, 211, 1517], 'acetylcholine,': [87, 213], 'combined': [88, 214], 'velocity': [91, 217, 1469], 'sedimentation': [92, 218, 1470], 'profiles,': [93, 219], 'consistent': [95, 221], 'formation': [98, 224, 1063, 1223], 'native-like': [100, 226], 'AChRs.': [101, 227, 974, 1496], 'These': [102, 228, 1528, 4476], 'characteristics': [103, 229], 'imply': [104, 230], 'that': [105, 114, 231, 240, 336, 373, 452, 477, 506, 521, 533, 631, 1040, 1052, 1257, 1331, 1499, 1520, 1531, 1541, 1821, 1840, 1878, 1934, 2019, 2123, 2610, 2847, 3156, 3309, 3312, 3363, 3693, 3967, 4242, 4321, 4399, 4497, 4514, 4552, 4614], 'ECD': [108, 120, 234, 246, 1007, 1020, 1042, 1075, 1345, 1399, 1411, 1423, 1436, 1495, 1534, 1539, 1635, 1901, 2171, 3420, 4172, 4254, 4282, 4345, 4368], 'can': [109, 235, 1021, 1542], 'form': [110, 236, 502, 603, 632, 1251, 4545], 'a': [111, 116, 237, 242, 367, 525, 650, 1010, 1015, 1261, 1536, 1544, 1589, 1670, 1683, 1722, 1893, 1910, 1968, 2007, 2079, 2230, 2248, 2282, 2297, 2368, 2376, 2667, 2714, 2832, 2905, 3079, 3220, 3307, 3686, 3811, 3817, 4234, 4286, 4361, 4365, 4508, 4574, 4585], 'water-soluble': [112, 238, 1406, 1504, 1537, 4366], 'AChR': [113, 239, 590, 771, 1003, 1060, 1263, 1511, 1540, 1748, 3433, 3524, 3577, 4155], 'is': [115, 241, 534, 622, 875, 1387, 2020, 3236, 3242, 3260, 3265, 3292, 3300, 3306, 3313, 4243, 4315, 4371], 'model': [117, 243, 1013], 'full-length': [123, 249, 1016, 1262, 1414, 1525, 1557, 2183, 3416, 3702, 3887], 'AChR.': [125, 251, 1527, 4369], 'Nicotinic': [252], 'receptors': [254, 380, 982], '(AChRs)': [255], '1The': [256, 290], 'abbreviations': [257, 291], 'used': [258, 292, 2486, 3158, 3322], 'are:': [259, 293], 'AChR,': [260, 294, 657, 1017, 1416], 'receptor;': [263, 297], 'ACh,': [264, 298], 'acetylcholine;': [265, 299], 'αBgt,': [266, 300], 'α-bungarotoxin;': [267, 301], 'ECD,': [268, 302, 4188], 'domain;': [270, 304], 'EK,': [271, 305], 'enterokinase;': [272, 306], 'ER,': [273, 307], 'endoplasmic': [274, 308], 'reticulum;': [275, 309], 'GPI,': [276, 310], 'glycophosphatidylinositol;': [277, 311], 'M1–4,': [278, 312], 'domains': [280, 314, 629], '1–4;': [281, 315], 'WS,': [282, 316], 'water-soluble;': [283, 317], 'mAb,': [284, 318], 'monoclonal': [285, 319, 3854, 4385], 'antibody;': [286, 320], 'PBS,': [287, 321, 3070], 'phosphate-buffered': [288, 322, 2738], 'saline.': [289, 323], 'are': [324, 429, 457, 481, 514, 522, 592, 635, 645, 773, 990, 1053, 1405, 1935, 3388, 3410], 'integral-membrane,': [325], 'pentameric': [326], 'in': [329, 338, 490, 768, 779, 812, 900, 947, 1026, 1055, 1218, 1439, 1456, 1460, 1726, 1924, 1944, 2336, 2344, 2398, 2508, 2516, 2535, 2546, 2569, 2574, 2689, 2703, 2733, 2737, 2826, 2879, 2913, 2938, 2967, 3032, 3056, 3087, 3115, 3120, 3147, 3203, 3248, 3278, 3385, 3408, 3439, 3443, 3461, 3465, 3641, 3645, 3685, 3707, 3711, 3743, 3770, 3810, 3859, 3894, 3915, 3951, 4047, 4078, 4091, 4111, 4149, 4159, 4324, 4347, 4394, 4543, 4628], 'central': [331], 'peripheral': [333], 'nervous': [334], 'systems': [335], 'participate': [337], 'signal': [339, 3239, 3245, 3311], 'transmission': [340], 'associated': [341], 'release': [344], '(ACh).': [347], 'A': [348, 2139, 2216, 2401, 2548, 2683], 'considerable': [349], 'collection': [350], 'studies': [352, 1549], 'cell': [355, 3721], 'biology,': [356], 'electrophysiology,': [357], 'structure': [359, 871, 1476, 1479], 'makes': [360], 'them': [361], 'best': [363], 'characterized': [364], 'superfamily': [368, 979, 1552], 'homologous': [370, 518, 763, 791], 'neurotransmitter-gated': [371], 'includes': [374, 4185], 'glycine,': [375], 'γ-aminobutyric': [376], 'acidA,': [377], '5-hydroxytryptamine3': [379], '(1Lindstrom': [381], 'J.': [382, 399, 401, 548, 570, 744, 828, 921, 952, 1148, 1152, 1155, 1270, 1292, 1572, 1622, 1710, 1759, 1805, 1865, 1990, 2045, 2385, 2625, 2807, 3370, 3653, 3728, 3729, 3872, 3988, 4011, 4430], 'Narahashi': [383], 'T.': [384, 1170, 1601, 2623, 4009], 'Ion': [385], 'Channels.': [386], '4.': [387], 'Plenum': [388], 'Press,': [389], 'New': [390], 'York1996:': [391], '377-450Google': [392], 'Scholar,': [393, 410, 558, 734, 843, 918, 931, 1095, 1111, 1124, 1144, 1166, 1181, 1194, 1285, 1302, 1616, 2056], '2Hucho': [394], 'F.': [395, 851, 1361], 'Tsetlin': [396], 'V.I.': [397], 'Machold': [398], 'Eur.': [400, 3987], 'Biochem.': [402, 3341, 3989], '1996;': [403, 955, 1273, 1295, 1321], '239:': [404], '539-557Crossref': [405], 'PubMed': [406, 422, 554, 575, 751, 839, 861, 914, 927, 938, 958, 1091, 1107, 1120, 1140, 1164, 1177, 1190, 1206, 1237, 1281, 1298, 1324, 1372, 1580, 1612, 1715, 1767, 1810, 1870, 1995, 2054, 2067, 2631, 2812, 3346, 3375, 3659, 3738, 3880, 3993, 4017, 4435], 'Scopus': [407, 423, 555, 576, 731, 752, 840, 862, 915, 928, 939, 959, 1092, 1108, 1121, 1141, 1178, 1191, 1207, 1238, 1282, 1299, 1373, 1581, 1613, 1716, 1768, 1811, 1871, 1996, 2068, 2632, 2813, 3347, 3376, 3660, 3881, 3994, 4018, 4436], '(205)': [408], 'Google': [409, 425, 557, 578, 733, 754, 842, 864, 917, 930, 941, 961, 1094, 1110, 1123, 1143, 1165, 1180, 1193, 1209, 1240, 1284, 1301, 1325, 1375, 1583, 1615, 1628, 1718, 1770, 1813, 1873, 1998, 2055, 2070, 2391, 2634, 2815, 3349, 3378, 3662, 3739, 3883, 3996, 4020, 4438], '3Karlin': [411], 'A.': [412, 849, 1365, 2032, 2042], 'Akabas': [413], 'M.H.': [414], 'Neuron.': [415, 907, 1084, 1133, 1230, 1573, 1760, 3873], '1995;': [416, 831, 908, 935, 1134], '15:': [417, 909], '1231-1244Abstract': [418], 'Full': [419, 748, 834, 836, 911, 1088, 1104, 1137, 1161, 1203, 1234, 1276, 1278, 1577, 1764, 2051, 3735, 3877], 'Text': [420, 749, 835, 837, 912, 1089, 1105, 1138, 1162, 1204, 1235, 1277, 1279, 1578, 1765, 2052, 3736, 3878], 'PDF': [421, 750, 838, 913, 1090, 1106, 1139, 1163, 1205, 1236, 1280, 1579, 1766, 2053, 3737, 3879], '(563)': [424], 'Scholar).': [426, 579, 755, 865, 962, 1210, 1241, 1326, 1376, 1629, 1771, 1814, 1874, 2392, 2635, 2816, 3379, 4021, 4439], 'Muscle-type': [427], 'AChRs': [428, 451, 476, 505, 513, 532, 815, 887, 989, 1395, 3437, 3453, 3459, 3639, 3710, 3717], 'composed': [430, 515], 'four': [432, 627], 'different': [433], 'subunits': [434, 467, 520, 675, 772, 1051, 1404], 'composition': [438, 3041], '(α1)2(β1)δ(γ': [439], 'or': [440, 465, 689, 972, 2598, 2790, 2942, 3189, 3194, 3297, 3431, 3496, 3518, 3550, 3614, 3634, 3679, 3701, 3849], 'ε)': [441, 711], 'bind': [443, 455, 479], 'snake': [445], 'venom': [446, 3973], 'toxin': [447], 'α-bungarotoxin': [448], '(αBgt).': [449], 'Neuronal': [450, 475], 'do': [453, 478], 'not': [454, 1388, 2176, 3314], 'αBgt': [456, 480, 1515, 2862, 3030], 'formed': [458, 482, 1004, 1396], 'from': [459, 483, 647, 877, 888, 1005, 1397, 1648, 1694, 1734, 1956, 2288, 2475, 2581, 2768, 2838, 2842, 2977, 3333, 3428, 3435, 3454, 3457, 3483, 3494, 3505, 3516, 3537, 3548, 3601, 3612, 3631, 3637, 3666, 3677, 3690, 3718, 3753, 3829, 3910, 3971, 4027, 4273, 4317, 4343, 4445, 4500], 'combinations': [460], 'α2,': [462], 'α3,': [463], 'α4,': [464], 'α6': [466], 'β2,': [469], 'β3,': [470], 'β4,': [471], 'and/or': [472], 'α5': [473], 'subunits.': [474, 494, 512], 'α7,': [484, 498], 'α8,': [485, 499], 'α9': [487, 501], 'subunits,': [488, 712], 'perhaps': [489], 'combination': [491], 'unknown': [493], 'When': [495], 'heterologously': [496], 'expressed,': [497], 'functional': [503], 'homomeric': [504, 813, 1333], 'appear': [507, 1069], 'to': [508, 693, 775, 792, 797, 806, 808, 1070, 1221, 1339, 1378, 1448, 1459, 1639, 1653, 1697, 1739, 1786, 1886, 1938, 1959, 2091, 2112, 2208, 2263, 2551, 2614, 2676, 2723, 2770, 2844, 2855, 2867, 3003, 3037, 3159, 3219, 3251, 3287, 3328, 3755, 3912, 3965, 4001, 4200, 4206, 4219, 4223, 4275, 4298, 4336, 4359, 4364, 4412, 4527, 4609], 'contain': [509, 595], 'five': [510, 517], 'identical': [511, 2111], 'membrane-spanning': [519], 'ordered': [523], 'around': [524, 665, 679, 799, 1349], 'central,': [526], 'cation-selective': [527], 'channel.': [528, 612], 'topology': [530], 'predicted': [535], 'hydrophobicity': [537], 'plots': [538], 'has': [539, 967, 983, 1837], 'received': [540], 'substantial': [541], 'experimental': [542], 'support': [543], '(4Chavez': [544], 'R.A.': [545, 1146], 'Hall': [546, 1082, 1098, 1114, 1153, 1228, 1268, 1290, 1313], 'Z.W.': [547, 1083, 1099, 1115, 1154, 1229, 1269, 1291, 1314], 'Cell': [549, 1198, 1293], 'Biol.': [550, 727, 829, 923, 954, 1156, 1199, 1271, 1294, 1320, 2046, 3730], '1992;': [551, 1101, 1158, 1187, 1200], '116:': [552], '385-393Crossref': [553], '(55)': [556], '5Anand': [559], 'R.': [560, 904, 1564, 1620, 1700, 1751, 1795, 1855, 1980, 2383, 2797, 3649, 3864, 4420], 'Bason': [561, 1701, 1796, 1856, 1981, 2798, 4421], 'L.': [562, 1702, 1797, 1857, 1982, 2799, 4422], 'Saedi': [563, 1703, 1798, 1858, 1983, 2800, 3725, 4423], 'M.S.': [564, 1704, 1799, 1859, 1984, 2801, 3726, 4424], 'Gerzanich': [565, 1705, 1800, 1860, 1985, 2802, 4425], 'V.': [566, 1618, 1706, 1801, 1861, 1986, 2381, 2803, 4426], 'Peng': [567, 1707, 1802, 1862, 1987, 2804, 3650, 4427], 'X.': [568, 1708, 1803, 1863, 1988, 2805, 3651, 4428], 'Lindstrom': [569, 1571, 1621, 1709, 1758, 1804, 1864, 1989, 2384, 2806, 3652, 3727, 3871, 4429], 'Biochemistry.': [571, 1368, 1711, 1806, 1866, 1991, 2063, 2808, 4431], '1993;': [572, 924, 1712, 1807, 1867, 1992, 2048, 2809, 3372, 3656, 4432], '32:': [573, 1713, 1808, 1868, 1993, 2810, 4433], '9975-9984Crossref': [574, 1714, 1809, 1869, 1994, 2811, 4434], '(37)': [577, 1717, 1812, 1872, 1997, 2814, 4437], 'approximately': [581, 2323, 4528], '200': [582, 995, 4031], 'residues': [583, 668, 680, 764, 786, 1695, 1830, 1957, 1965, 1971, 2004, 2010, 2076, 2083, 2145, 2265, 4241], 'at': [584, 698, 765, 896, 944, 1480, 2093, 2166, 2189, 2204, 2330, 2469, 2591, 2604, 2644, 2660, 2700, 2874, 2935, 2950, 3010, 3051, 3132, 3180, 3395, 3792, 3801, 3900, 3921, 3962, 4056, 4099, 4117, 4249, 4263, 4277, 4302, 4373, 4464, 4473], 'half': [587, 1342], 'each': [589, 1500, 2289, 2318, 2856, 2880, 3057, 3104, 3121, 3825, 4525], 'extracellular,': [593], 'areN-glycosylated,': [594], 'sites': [596, 697, 1068, 1256, 1933, 2119, 3761, 4164], 'agonist': [598, 781, 810, 1482], 'antagonist': [600], 'binding,': [601], 'vestibule': [605], 'through': [606, 4226, 4409], 'which': [607, 1489, 1632, 1883, 4142], 'cations': [608], 'reach': [609], 'Relatively': [613], 'little': [614], 'remainder': [617, 1031, 2106], 'primary': [620, 663, 758], 'sequence': [621, 664, 759, 1559, 1647, 1680, 1687, 1920, 1963, 2002, 2016, 2074, 2088, 2109, 2184, 2201, 2226, 2242, 2257, 2261, 4173, 4296, 4320], 'extracellular.': [623], 'Three': [624], '(M1–M3)': [630], 'channel': [634], 'grouped': [636], 'together': [637], 'following': [638, 2539, 2572], 'separated': [646, 2427, 2481, 2712], 'M4': [648], 'large': [651, 992], 'cytoplasmic': [652, 1213, 1383, 2524, 3861], 'loop.': [653], 'muscle-type': [656, 1059], 'distinct': [659], 'regions': [660], 'amino': [666, 2143, 4239, 4501], 'acid': [667, 1679, 1918, 2144, 2224, 4240, 4502], '86–93,': [669], '149,': [670], '190–198': [672], 'α1': [674, 795, 1216, 1248], 'peptide': [677, 1894, 4235, 4326], 'loops': [678], '34,': [681], '55–59,': [682], '113–119,': [683], '174–180': [685], 'γ': [688, 709, 2906, 3080, 3933, 4128], 'δ': [690, 704, 1250], 'contribute': [692, 807], 'ACh': [695, 1519, 3086, 3195, 3277], 'interfaces': [700, 767], 'between': [701, 706, 1050, 1896, 1926, 2148, 2193, 2235, 4195, 4245], 'α': [702, 707], '(or': [710], 'based': [713, 1351], 'on': [714, 1073, 1352, 2027, 2281, 2296, 2713, 4520, 4599], 'photoaffinity': [715], 'labeling': [716], 'site-directed': [718], 'mutagenesis': [719], '(6Galzi': [720], 'J.-L.': [721, 819, 821, 845], 'Changeux': [722, 824, 854], 'J.-P.': [723, 825, 855], 'Curr.': [724], 'Opin.': [725], 'Struct.': [726], '1994;': [728, 1174, 1231, 1369, 1625, 2388], '4:': [729], '554-565Crossref': [730], '(198)': [732, 2633, 4019], '7Tsigelny': [735], 'I.': [736], 'Sugiyama': [737, 1309], 'N.': [738, 906, 920, 933, 951], 'Sine': [739, 1129], 'S.M.': [740, 1130], 'Taylor': [741, 1131], 'P.': [742, 1079, 1081, 1132, 1568, 1755, 3868], 'Biophys.': [743], '1997;': [745], '73:': [746], '52-66Abstract': [747], '(69)': [753], 'Because': [756], 'topological': [761], 'similarity,': [762], 'subunit-subunit': [766], 'other': [769, 1876, 3356, 3490, 3512, 3544, 3608, 3673], 'neuronal': [770], 'expected': [774], 'have': [776, 803, 891, 1336, 1491, 3359], 'similar': [777, 1885], 'roles': [778], 'site.': [783], 'example,': [785], 'those': [793, 798, 1522], 'γ55': [800], 'δ57': [802], 'been': [804, 968, 984, 1337, 1838, 2612, 2849, 3360, 3695, 3969, 4554], 'shown': [805, 1839, 3384, 3407], '(8Corringer': [816], 'P.-J.': [817], 'Galzi': [818], 'Eiselé': [820], 'Bertrand': [822, 826, 846, 852], 'S.': [823, 853, 1097, 1308, 1363, 3366], 'D.': [827, 847, 1150, 3986], 'Chem.': [830, 1157, 1272, 2047, 3731], '270:': [832], '11749-11752Abstract': [833], '(120)': [841], '9Galzi': [844], 'Thiéry-Devillers': [848], 'Revah': [850], 'FEBS': [856, 3654], 'Lett.': [857, 3655], '1991;': [858, 1085, 1117], '294:': [859], '198-202Crossref': [860], '(137)': [863], 'Our': [866], 'knowledge': [867], 'molecular': [870, 4530], 'AChRs,': [873, 1488], 'however,': [874, 966], 'far': [876], 'complete.': [878], 'Electron': [879], 'diffraction': [880], 'methods': [881], 'using': [882, 2277, 2303, 2904, 3078, 3225], 'two-dimensional,': [883], 'tubular': [884], 'arrays': [885], 'Torpedo': [889], 'californica': [890, 3715], 'successfully': [892], 'yielded': [893], 'details': [895], '9': [897], 'Å': [898, 946], 'resolution': [899], 'dimensions': [902], '(10Beroukhim': [903], 'Unwin': [905], '323-331Abstract': [910], '(82)': [916], '11Unwin': [919], 'Mol.': [922, 953, 1171, 1184, 1623, 2386], '229:': [925], '1101-1124Crossref': [926], '(715)': [929], '12Unwin': [932], 'Nature.': [934, 1116], '373:': [936], '37-43Crossref': [937], '(905)': [940], 'Scholar)': [942, 1584, 3740, 3884, 3997], '7.5': [945], 'two-dimensional': [948], 'projection': [949], '(13Unwin': [950], '257:': [956], '586-596Crossref': [957], '(99)': [960], 'Achieving': [963], 'higher': [964, 4483], 'resolution,': [965], 'elusive': [969], 'membrane-bound': [971, 2364], 'detergent-solubilized': [973], 'No': [975], 'member': [976], 'integral-membrane': [981], 'crystallized,': [985], 'intact': [988], 'too': [991], '(more': [993], 'than': [994, 2984, 3167, 4484, 4596], 'kDa)': [996], 'nuclear': [998], 'magnetic': [999], 'resonance': [1000], 'spectroscopy.': [1001], 'An': [1002], 'may': [1008, 1843], 'suitable': [1011], 'if': [1018], 'both': [1022, 2488], 'fold': [1023], 'oligomerize': [1025], 'absence': [1028, 4093], 'subunit.': [1034], 'Several': [1035], 'lines': [1036], 'evidence': [1038], 'suggest': [1039], 'meets': [1043], 'these': [1044, 4290, 4457], 'requirements.': [1045], 'First,': [1046], 'specific': [1048, 2988, 3171], 'interactions': [1049], 'important': [1054], 'mature': [1065, 1745], 'depend': [1071], 'primarily': [1072], '(14Gu': [1076], 'Y.': [1077, 3338], 'Camacho': [1078], 'Gardner': [1080], '6:': [1086], '879-887Abstract': [1087], '(65)': [1093], '15Verrall': [1096], 'Cell.': [1100], '68:': [1102], '23-31Abstract': [1103], '(122)': [1109], '16Yu': [1112], 'X.M.': [1113, 1227], '352:': [1118], '64-67Crossref': [1119], '(70)': [1122], '17Kreienkamp': [1125], 'H.-J.': [1126], 'Maeda': [1127], 'R.K.': [1128], '14:': [1135], '1-20Abstract': [1136], '(92)': [1142], '18Chavez': [1145], 'Maloof': [1147], 'Beeson': [1149], 'Newsom-Davis': [1151], '267:': [1159], '23023-23034Abstract': [1160], '19Sumikawa': [1167], 'K.': [1168, 1183, 1603], 'Nishizaki': [1169], 'Brain': [1172, 1185], 'Res.': [1173, 1186, 1608], '25:': [1175], '257-264Crossref': [1176], '(20)': [1179], '20Sumikawa': [1182], '13:': [1188, 1232], '349-353Crossref': [1189], '(27)': [1192], '21Hall': [1195], 'Z.': [1196], 'Trends': [1197], '2:': [1201], '66-68Abstract': [1202], '(18)': [1208], 'long': [1212, 1382], 'loop': [1214, 1384], 'participates': [1217], 'subsequent': [1220, 1458], 'heterodimers': [1225, 1252], '(22Yu': [1226], '247-255Abstract': [1233], '(44)': [1239, 2069], 'Second,': [1242], 'membrane-tethered': [1243], 'ECDs': [1244], 'mouse': [1246], 'muscle': [1247], 'ligand': [1254, 1465, 2494, 3198, 3401, 3818], 'reflect': [1258], 'properties': [1259, 1467, 1529, 4210], '(23Wang': [1264], 'Z.-Z.': [1265, 1287, 1304], 'Hardy': [1266, 1288], 'S.F.': [1267, 1289], '271:': [1274], '27575-27584Abstract': [1275], '(38)': [1283], '24Wang': [1286], '135:': [1296], '809-817Crossref': [1297], '(15)': [1300], '25Wang': [1303], 'Fuhrer': [1305], 'C.': [1306, 2038, 3117], 'Shtrom': [1307], 'J.E.': [1310], 'Ferns': [1311], 'M.J.': [1312], 'Cold': [1315], 'Spring': [1316], 'Harbor': [1317], 'Symp.': [1318], 'Quant.': [1319], '61:': [1322], '363-371Crossref': [1323], 'Third,': [1327], 'sequences': [1328], 'affect': [1332], 'also': [1335, 3358, 4258], 'localized': [1338], 'an': [1347, 1510, 2304, 2724, 3857, 4270, 4465, 4563], 'area': [1348], 'M1': [1350, 1429, 1438, 1445, 1454, 1880, 1943, 2194, 2213, 4196, 4260, 4284, 4342, 4377], 'chimeras': [1353], 'α3': [1357], '(26Garcı́a-Guzmán': [1358], 'M.': [1359, 1367, 1570, 1757, 2621, 3870, 4007], 'Sala': [1360, 1362], 'Campos-Caro': [1364], 'Criado': [1366], '33:': [1370], '15198-15203Crossref': [1371], '(54)': [1374], 'According': [1377], 'report,': [1380], 'essential': [1389], 'oligomerization.': [1391], 'To': [1392, 1907, 2179], 'determine': [1393], 'whether': [1394], '(residues': [1400], '1–208)': [1401], 'we': [1417, 1490], 'expressed': [1418, 3438, 3460, 3640], 'two': [1419, 3484, 3506, 3538, 3602, 3667], 'constructs': [1420, 1443, 4397], 'retained': [1430], 'one': [1432, 1505, 2843], 'construct': [1433, 1877], 'Xenopus': [1440], 'explore': [1449], 'feasibility': [1451, 4339], 'removing': [1453, 4341], 'vitroprocessing': [1457], 'vivo': [1461], 'synthesis.': [1462, 4352], 'examined': [1464], 'profiles': [1471], 'as': [1472, 1493, 2503, 2530, 2564, 2691, 3042, 4066, 4134], 'indicators': [1473], 'global': [1475], 'local': [1478], 'site': [1484, 1725, 1817, 2024, 2192, 2206, 2238, 2246], 'resulting': [1487, 2198], 'designated': [1492, 4231], 'found': [1498], 'construct,': [1501, 2162, 4183, 4230], 'including': [1502], 'M1,': [1507, 4189, 4539], 'assembles': [1508], 'into': [1509, 1588, 3834, 4546], 'for125I-labeled': [1514], '(125I-αBgt),': [1516], 'match': [1521], 'demonstrate': [1530, 4207], 'forms': [1535], 'starting': [1545], 'point': [1546, 2910, 2964], 'channels.': [1555], 'cDNA': [1558], 'chicken': [1561, 1746], '(27Schoepfer': [1563, 1750, 3863], 'Conroy': [1565, 1752, 3865], 'W.G.': [1566, 1753, 3724, 3866], 'Whiting': [1567, 1754, 3867], 'Gore': [1569, 1756, 3869], '1990;': [1574, 1761, 3732, 3874], '5:': [1575, 1762, 3875], '35-48Abstract': [1576, 1763, 3876], '(407)': [1582, 1769, 3882], 'previously': [1585, 2377], 'cloned': [1587], 'modified': [1590, 2137, 2249], 'SP64T': [1591, 2250], 'vector': [1593], '(28Melton': [1594], 'D.A.': [1595], 'Krieg': [1596], 'P.A.': [1597], 'Rebagliati': [1598], 'M.R.': [1599, 1605], 'Maniatis': [1600], 'Zinn': [1602], 'Green': [1604], 'Nucleic': [1606], 'Acids': [1607], '1984;': [1609, 2628, 4014], '12:': [1610], '7035-7056Crossref': [1611], '(4054)': [1614], '29Gerzanich': [1617], 'Anand': [1619, 2382], 'Pharmacol.': [1624, 2387, 3342, 3371], '45:': [1626, 2389], '212-220PubMed': [1627, 2390], 'α7M1,': [1631, 3699, 3844, 4184], 'encodes': [1633], 'up': [1638, 4199], 'start': [1641, 2210], 'M2,': [1643], 'coding': [1646, 1674, 1914, 2214, 2220], 'beginning': [1650, 1904], 'M2': [1652, 4198, 4220], 'past': [1654], 'native': [1656, 1732, 2087, 2260, 4295], 'stop': [1657, 1684, 2231], 'codon': [1658, 2232], 'removed': [1660, 2520], 'digestion': [1662, 1832, 2133], 'withBglII': [1663], 'BsmI.': [1665, 1835], 'It': [1666, 1836, 4203, 4370], 'replaced': [1668], 'double-stranded': [1671, 1911, 2217], 'oligonucleotide': [1672, 1912, 2218, 2284], 'cassette': [1673, 1913, 2219], 'in-frame': [1675], '19-amino': [1678], 'SQVTGEVIFQTPLIKNPRV': [1681], 'signal.': [1685], 'This': [1686], 'contained': [1688], 'epitope': [1690, 1775, 1823, 1850, 1975, 2127, 2269, 3858], 'mAb': [1692, 1773, 1787, 1977, 2125, 2271, 2608, 2788, 2791, 3004, 3525, 3560, 3841, 3845, 3850, 4387, 4390], '142': [1693, 1774, 2609, 2789, 3526, 3842, 4388], '2': [1696, 2467, 2589, 2758, 3352], '17': [1698], '(5Anand': [1699, 1794, 1854, 1979, 2796, 4419], 'Scholar),': [1719, 3350], 'followed': [1720, 2228, 3924, 4120], 'MluI': [1723, 1816], 'restriction': [1724, 2118], 'DNA': [1728, 1962, 2001, 2073, 2285, 2287], 'sequence.': [1729, 2215], 'last': [1731], 'residue': [1733, 1919, 2225, 4201], 'Ile240,': [1737, 4264], 'according': [1738, 2675], 'numbering': [1741], 'scheme': [1742], 'introduced': [1777, 1967, 2006, 2078], 'immunoblotting': [1779, 4406], 'protein': [1785, 2366, 2506, 2533, 2567, 2641, 2837, 2975, 3751, 3950, 3956, 4024, 4534, 4561], '142-coated': [1788, 3005], 'plastic': [1789, 2779, 3837, 4413], 'wells': [1790, 2818, 2886, 2921, 2945, 3063, 3127, 3186, 4414], 'solid-phase': [1792, 2794, 4416], 'assays': [1793, 2492, 2795, 3399, 4418], 'so': [1820, 2122, 4398], 'insert': [1824], 'could': [1825, 2135, 4402], 'extended': [1827], 'additional': [1829], 'withMluI': [1833], 'such': [1841], 'extension': [1842], 'necessary': [1845], 'accessibility': [1847], 'antibody': [1853, 3855], 'α7EK,': [1882, 1909, 2361, 2831, 3700, 3848, 4232], 'α7M1': [1887, 2359, 2595, 2829, 4070, 4449, 4460, 4491, 4600, 4633], 'except': [1888, 3045], 'inclusion': [1891], 'spacer': [1895, 4236, 4327], 'end': [1898, 1950, 2096, 2168, 4305], 'M1.': [1906, 2178, 4227, 4256, 4311], 'prepare': [1908, 2180], '38-amino': [1917], 'TMRRRTGTVSISPESDRPDLSTFTSDDDDKILERRRTL': [1921], 'ligated': [1923, 2234], 'frame': [1925], 'proximal': [1928, 2150, 2207, 4218], 'BsmAI': [1929, 2237], 'distal': [1931, 2095, 2156], 'HgaI': [1932], 'nearly': [1936], 'juxtaposed': [1937], '5′': [1940], 'side': [1941], 'α7M1.': [1945, 2113, 4266], 'Residues': [1946, 2253], '1–6': [1947, 2254], 'reconstructed': [1948, 2085, 2258], 'Thr203': [1958], 'Thr208;': [1960, 2264], '7–8': [1966], 'KpnI': [1969], 'site;': [1970, 2009, 2081], '9–23': [1972], '236': [1978, 2126, 2792, 3561, 3846, 4391], 'Scholar);': [1999, 2071], '24–25': [2005], 'SpeI': [2008], '26–31': [2011], '(DDDDKI)': [2012], 'specificity': [2015], 'EK': [2018], 'modeled': [2021], 'its': [2023], 'proteolysis': [2026, 4330, 4350], 'trypsinogen': [2028], '(30LaVallie': [2029], 'E.R.': [2030], 'Rehemtulla': [2031], 'Racie': [2033], 'L.A.': [2034], 'DiBlasio': [2035], 'E.A.': [2036], 'Ferenz': [2037], 'Grant': [2039], 'K.L.': [2040], 'Light': [2041], 'McCoy': [2043], 'J.M.': [2044], '268:': [2049], '23311-23317Abstract': [2050], '31Anderson': [2057], 'L.E.': [2058], 'Walsh': [2059], 'K.A.': [2060], 'Neurath': [2061], 'H.': [2062, 3984], '1977;': [2064], '16:': [2065], '3354-3360Crossref': [2066], '32–33': [2077], 'XhoI': [2080], '34–38': [2084], 'Arg205': [2090, 4297], 'Leu209': [2092, 4248], 'insert.': [2099], 'Beginning': [2100], 'Tyr210': [2102], '(native': [2103], 'numbering),': [2104], 'KpnI,': [2115], 'XhoI,': [2116], 'andSpeI': [2117], 'target': [2130], 'protease': [2132], 'easily': [2134], 'readily.': [2138], 'total': [2140], '27': [2142, 4238], 'inserted': [2147], 'copy': [2151, 2157], 'Thr208': [2153, 4246, 4299], 'Arg205.': [2159], 'α7WS,': [2163, 2181, 2497, 2991, 3097, 4356], 'did': [2175], 'include': [2177], 'cut': [2188, 2203], 'BglII': [2191], 'M2.': [2196], 'theBsmAI': [2205], '22-amino': [2223], 'TMRRRTQVTGEVIFQTPLIKNP': [2227], 'EcoRI': [2245], 'vector.': [2252], 'Arg203': [2262], '7–22': [2266], 'constituted': [2267], '142.': [2272, 2760], 'oligonucleotides': [2274], 'synthesized': [2276, 2302], 'phosphoramidite': [2279], 'method': [2280], 'MilliGen': [2283], 'synthesizer.': [2286], 'plasmids': [2293], 'purified': [2295], 'CsCl': [2298], 'gradient.': [2299], 'cRNA': [2300, 2327, 2852, 3704, 4452], 'SP6': [2305], 'mMessage': [2306], 'mMachine™': [2307], 'kit': [2308], '(Ambion,': [2309], 'Austin,': [2310], 'TX)': [2311], 'linearized': [2313], 'DNA.': [2314], 'cytoplasm': [2316], 'oocyte': [2319], 'injected': [2321, 2513, 2850, 3696, 4447, 4555], '50': [2324, 2406, 3335], 'ng': [2325], 'incubated': [2329, 2602, 2756, 2872, 2947, 3008, 3049, 3129], '18': [2331, 2658], '°C': [2332, 2606, 2646, 2662, 2702, 2952, 3012, 3134, 3809, 3964], '3–5': [2334], 'days': [2335], '50%': [2337], "Leibovitz's": [2338], 'L-15': [2339, 2510, 2995, 3020, 3154], 'medium': [2340, 2511, 2996, 3155, 4549], '(Life': [2341], 'Technologies,': [2342], 'Inc.)': [2343], '10': [2345, 2351, 2355, 2744, 3778], 'mm': [2346, 2403, 2407, 2410, 2413, 2416, 2419, 2444, 2448, 2451, 2454, 2459, 2652, 2742, 2745, 3776, 3779, 3783, 3786, 3790, 4035], 'HEPES,': [2347], 'pH': [2348, 2421, 2748, 3793], '7.5,': [2349], 'containing': [2350, 2370, 2709, 2750, 2894, 3752], 'units/ml': [2352], 'penicillin': [2353], 'μg/ml': [2356], 'streptomycin.': [2357], 'extraction': [2362, 2478, 2573], 'buffer': [2369, 2400, 2434, 2441, 2547, 2575, 2708, 3038, 3043, 3116, 3178, 3708, 3744, 3916, 4112], 'Triton': [2371, 2869, 2927, 3089, 3444, 3466, 3580, 3596, 3646, 3772, 4046, 4442], 'X-100': [2372, 3445, 3467, 3647, 4443], 'accomplished': [2374], 'reported': [2378], 'procedure': [2379], '(29Gerzanich': [2380], 'Oocytes': [2393], 'homogenized': [2395], 'hand': [2397, 2545], 'ice-cold': [2399, 2892, 3069], '(50': [2402], 'sodium': [2404, 2445, 2746, 3780], 'phosphate,': [2405, 2446, 2747, 3781], 'NaCl,': [2408, 2449, 2743, 3777], '5': [2409, 2412, 2415, 3782, 3785], 'EDTA,': [2411, 2452, 3787], 'EGTA,': [2414, 2455, 3784], 'benzamidine,': [2417], '15': [2418], 'iodoacetamide,': [2420, 2460], '7.5).': [2422], 'membrane-containing': [2424], 'fraction': [2425, 2474, 2500, 2518, 2525, 2538, 2559], 'centrifugation,': [2429], 'washed': [2431, 2888, 2923, 3022, 3065, 3906, 4105], 'twice': [2432], 'A,': [2435], 'then': [2437, 2956, 3999], 'extracted': [2439, 3706], 'B': [2442, 2576, 3174, 3917], '(40': [2443], '40': [2447, 3895, 4474], '4': [2450, 2453, 2456, 2470, 2592, 2605, 2778, 2875, 2936, 2951, 3011, 3052, 3133, 3808, 3836, 3901, 3911, 3922, 3963, 4064, 4100, 4118], 'mmbenzamidine,': [2457], '12': [2458, 3913], '2%': [2461, 2648, 2710, 3204, 3595], 'Triton)': [2462, 3047], 'during': [2463, 2585], 'gentle': [2464, 2586], 'agitation': [2465, 2587], 'hours': [2468], '°C.': [2471, 2593, 2876, 3053], 'step': [2479, 2584, 3182], 'centrifugation': [2483, 2550], 'Western': [2489], 'blotting': [2490], 'binding.': [2495, 2989, 3172], 'secreted': [2499, 2599, 3017, 3096, 3949, 4542, 4560], 'defined': [2502, 2529, 2563, 4133], 'present': [2507, 2534, 2568, 4598], 'incubating': [2512], 'Particulates': [2515], 'centrifugation.': [2522], 'α7WS': [2527, 2561, 2600, 3202, 3937, 4540, 4557, 4615], 'homogenization': [2540, 2583], 'oocytes': [2543, 2846, 2979, 3000, 3162, 3440, 3462, 3642, 3692, 4446, 4551], 'sediment': [2552], 'insoluble,': [2554], 'membranous': [2555, 2579], 'component.': [2556], 'Triton-extracted': [2558, 2594], 'solvent': [2571], 'component': [2580], 'h': [2590, 2659, 2931, 2949, 3131, 3899, 3920, 4098, 4116], 'α7EK': [2597, 4257, 4333, 4451, 4471, 4496], 'overnight': [2603, 2873, 3009, 3050, 3961], 'had': [2611, 2848, 3694, 3968, 4553, 4616], 'coupled': [2613, 4000], 'Sepharose': [2615, 4002], 'CL-4B': [2616, 4003], '(Pharmacia)': [2617], 'CNBr': [2619, 4005], '(32Wilchek': [2620, 4006], 'Miron': [2622, 4008], 'Kohn': [2624, 4010], 'Methods': [2626, 4012], 'Enzymol.': [2627, 4013], '104:': [2629, 4015], '3-55Crossref': [2630, 4016], 'After': [2636, 2730, 3897, 4096], 'concentration': [2638, 3262, 3294, 3946], 'step,': [2639], 'eluted': [2643, 4026], '55': [2645, 2701], 'SDS': [2649], '20': [2651, 3754], 'β-mercaptoethanol.': [2653], 'Proteins': [2654], 'deglycosylated': [2656], '37': [2661, 4469], '1': [2664, 3233, 3305, 3430, 3633, 3789, 4109, 4151], 'unit': [2665], 'mixture': [2668], 'endoglycosidase': [2670], 'F': [2671, 2674], 'glycopeptidase': [2673], 'instructions': [2677], 'manufacturer': [2680], '(Boehringer': [2681], 'Mannheim).': [2682], 'sample': [2684, 2707], 'enzyme': [2686], 'run': [2688], 'parallel': [2690], 'negative': [2693], 'control.': [2694], 'Protein': [2695], 'denatured': [2697], 'reduced': [2699], 'SDS-polyacrylamide': [2704, 2717], 'gel': [2705, 2718], 'electrophoresis': [2706, 2719], 'SDS,': [2711], '13%': [2715], 'acrylamide': [2716], 'gel,': [2720], 'transferred': [2722], 'Immobilon-P': [2725], 'polyvinylidene': [2726], 'difluoride': [2727], 'membrane': [2728, 2754, 3712, 4225], '(Millipore).': [2729], 'being': [2731], 'blocked': [2732, 2820], '5%': [2734, 2985], 'powdered': [2735], 'milk': [2736], 'saline': [2739], '(PBS,': [2740], '100': [2741, 2883, 3060, 3124, 3756, 3775, 4034], '7.5)': [2749], '0.5%': [2751, 2895, 3771], 'Triton,': [2752, 2896], 'nm125I-mAb': [2759], 'Specific': [2761], 'activities': [2762], 'labeled': [2765], 'antibodies': [2766, 4386, 4411], 'ranged': [2767], '1017': [2769], '1018cpm/mol.': [2771], 'Labeling': [2772], 'visualized': [2774], 'autoradiography.': [2776], 'Immulon': [2777, 3835], 'microwells': [2780, 3006, 3838, 3904, 4103], '(Dynatech': [2781], 'Laboratories,': [2782], 'Chantilly,': [2783], 'VA)': [2784], 'coated': [2786, 3839], '3%': [2822], 'bovine': [2823], 'serum': [2824], 'albumin': [2825], 'PBS.': [2827, 3025], 'volume': [2833, 2878, 2993, 3055, 3119], 'Triton-solubilized': [2836, 2974], 'equivalent': [2840], 'added': [2854, 2866, 3002, 3036], 'microwell.': [2857], 'measurement': [2860, 3028], 'affinity,': [2863], '125I-αBgt': [2864, 3188, 3191, 3256, 3759, 3931, 4162], 'extract': [2870], 'Total': [2877, 3054, 3118], 'well': [2881, 3058, 3105, 3122], 'μl.': [2884, 3061, 3125], 'times': [2890, 3067], 'PBS': [2893], 'amount': [2899, 2959, 3073, 3112, 3140, 4138], 'radioactivity': [2901, 3075], 'measured': [2903, 2912, 2966, 2972, 3077, 3091, 3146, 3152, 3238], 'counter.': [2907, 3081], 'Each': [2908, 2962], 'data': [2909, 2963], 'duplicate.': [2914, 2968, 3148], 'competitive': [2917], 'inhibition': [2918, 3271], 'assays,': [2919], 'free': [2924], 'solution': [2928, 3773], '24': [2930, 3898, 4097], 'loaded': [2933], 'with125I-αBgt': [2934], 'nm': [2937], 'presence': [2940, 3280], 'ofl-nicotine': [2941], 'ACh.': [2943], '8': [2948, 3130], 'washing': [2954, 3098, 3136, 3926, 4122], 'measuring': [2957, 3138], 'radioactivity.': [2961, 3142], 'Nonspecific': [2969, 3149], 'extracts': [2976, 4444], 'uninjected': [2978, 3161], 'generally': [2981, 3164], 'less': [2983, 3166], 'above': [2997], 'about': [2998, 4480, 4567, 4610], 'six': [2999], 'capture': [3014, 3093], 'α7WS.': [3018], 'away': [3023], 'affinity': [3031, 3199, 3402, 3422], '0%': [3033, 3088, 3579], 'Triton,125I-αBgt': [3034], 'C': [3039, 3179, 3235, 4113, 4147], '(same': [3040], 'B,': [3044], 'Inhibition': [3082], 'nicotine': [3084, 3193, 3275, 3296, 4036], 'L-15,': [3100], 'loading': [3102, 3184], '0.6': [3107], 'nm125I-αBgt': [3108, 3914, 4110], 'appropriate': [3111], 'inhibitor': [3114], 'Data': [3143, 3636], 'points': [3144], 'incubate': [3160], '10%': [3168], 'Buffer': [3173], 'substituted': [3176], 'measurements': [3200, 3486, 3508, 3540, 3604, 3669], 'Triton.': [3205], 'dissociation': [3208, 3331], 'constants': [3209, 3332], 'K': [3210, 3381], 'd': [3211, 3382], 'for125I-αBgt': [3212], 'determined': [3214, 3283, 3482, 3493, 3504, 3515, 3536, 3547, 3600, 3611, 3665, 3676], 'least-squares,': [3216], 'nonlinear': [3217, 3285], 'fitting': [3218, 3286], 'Hill-type': [3221], 'equation': [3222, 3325], '(Equation': [3223, 3326], '1)': [3224], 'graphing': [3227], 'software': [3228], 'KaleidaGraph': [3229], '(Synergy': [3230], 'Software)': [3231], 'C=C0·11+KdLnEquation': [3232], 'where': [3234, 3290], '(counts/min),C': [3240], '0': [3241, 3299, 4148], 'maximal': [3244, 3302, 4137], '(which': [3246], 'corresponds': [3247], 'case': [3250], 'maximum': [3253], 'number': [3254], 'sites),': [3258], 'L': [3259, 3291], '125I-αBgt,n': [3264], 'Hill': [3267, 3628], 'coefficient.': [3268], 'half-maximal': [3270], 'constants,': [3272], 'IC50,': [3273], 'of125I-αBgt': [3281], 'Equation': [3288, 4150], '2,': [3289], 'ACh,C': [3298], 'signal,': [3303], 'andC': [3304], 'constant': [3308], 'represents': [3310], 'displaced': [3315], 'high': [3317], 'concentrations': [3318], 'agonist.': [3320], 'Cheng-Prusoff': [3324], '3)': [3327], 'estimate': [3329], 'IC': [3334], 'values': [3336, 3383, 3491, 3513, 3545, 3609, 3674, 4486], '(33Cheng': [3337], 'Prusoff': [3339], 'W.H.': [3340], '1973;': [3343], '22:': [3344], '3099-3108Crossref': [3345], '(12222)': [3348], 'C=C0·11+LIC50n+C1Equation': [3351], 'Kd=IC501+[αBgt]Kd,αBgtEquation': [3353], '3': [3354], 'although': [3355], 'equations': [3357], 'described': [3361], '(34Lazareno': [3365], 'Birdsall': [3367], 'N.J.M.': [3368], 'Br.': [3369], '109:': [3373], '1110-1119Crossref': [3374], '(143)': [3377], 'Table': [3386], 'I': [3387], 'average': [3390], 'standard': [3392, 3411], 'error': [3393], 'least': [3396], 'independent': [3398, 3485, 3498, 3507, 3520, 3539, 3552, 3603, 3616, 3668, 3681], 'unless': [3403], 'otherwise': [3404], 'noted.': [3405], 'Uncertainties': [3406], 'figures': [3409], 'errors.Table': [3412], 'ILigand': [3413], 'AChRsAChRLigand': [3421], '(K': [3423], 'd)αBgtn': [3424], '1-aHill': [3425], 'coefficient': [3426, 3629], 'n': [3427, 3630], 'Equations': [3429, 3632], '2.NicotinenAChnμmα7': [3432], '(full-length)1-bData': [3434], '(37).0.0016': [3446], '±': [3447, 3449, 3451, 3469, 3471, 3473, 3476, 3478, 3480, 3500, 3502, 3522, 3530, 3532, 3534, 3554, 3556, 3558, 3565, 3567, 3569, 3571, 3573, 3575, 3582, 3584, 3586, 3588, 3590, 3592, 3598, 3618, 3620, 3622, 3624, 3626], '0.00010.54': [3448], '0.0225': [3450], '4.7α7-containing': [3452], 'chick': [3455], 'brain1-bData': [3456], '(37).0.0017': [3468], '0.00011.4': [3470], '0.2100': [3472], '10α7M1': [3474], 'AChR0.0016': [3475], '0.00010.7': [3477], '0.11.0': [3479, 3533], '0.41-cValues': [3481], 'IC50.': [3488, 3510, 3542, 3606, 3671], 'All': [3489, 3511, 3543, 3607, 3672], 'more': [3497, 3519, 3551, 3615, 3680, 3940, 4593], 'measurements.1.2': [3499, 3521], '0.150': [3501], '201-cValues': [3503], '0.4α7EK': [3523], 'tether': [3527, 3562], 'assay0.0020': [3529], '0.00040.8': [3531], '0.31-cValues': [3535], 'measurements.1.7': [3553], '0.250': [3555], '201.3': [3557], '0.2': [3559], 'assay0.0029': [3564], '0.00060.8': [3566], '0.11.4': [3568], '0.71.1': [3570], '0.260': [3572], '301.1': [3574], '0.1α7WS': [3576], 'In': [3578, 3594], 'X-1000.0004': [3581], '0.00011.3': [3583], '0.10.09': [3585], '0.051.6': [3587], '0.11.3': [3589], '0.41.6': [3591], '0.3': [3593], 'X-1000.0017': [3597], '0.00011-cValues': [3599], 'measurements.1.1': [3617], '0.10.22': [3619], '0.011.7': [3621], '0.13.9': [3623], '0.32.0': [3625], '0.11-a': [3627], '2.1-b': [3635], '(37Anand': [3648], '327:': [3657], '241-246Crossref': [3658], '(116)': [3661], 'Scholar).1-c': [3663], 'Values': [3664], 'measurements.': [3682], 'Open': [3683], 'table': [3684], 'new': [3687], 'tab': [3688], 'Membranes': [3689], '10–20': [3691], 'B.': [3709, 3745], 'vesicles': [3713], 'fromT.': [3714], 'TE671': [3720], 'line': [3722], '(35Conroy': [3723], '265:': [3733], '21642-21651Abstract': [3734], 'About': [3746], '200-μl': [3747], 'aliquots': [3748, 3821], 'fmol': [3757], 'layered': [3763, 4039], 'onto': [3764, 4040], '5-ml': [3765, 4041], 'sucrose': [3766, 4042], 'gradients': [3767, 3796, 4043], '(5–20%': [3768], '(w/v))': [3769], 'NaN3': [3791], '7.5.': [3794], 'centrifuged': [3798, 4053], '75': [3799, 4054], 'min': [3800, 4055], '70,000': [3802, 4057], 'rpm': [3803, 4058], '(approximately': [3804, 3826, 4059], '340,000': [3805, 4060], '×g)': [3806], 'Beckman': [3812], 'NVT90': [3813], 'rotor.': [3814], 'determining': [3816], 'profile,': [3820], '11': [3823], 'drops': [3824, 4083], '130': [3827], 'μl)': [3828], 'gradient': [3831, 3891, 4051, 4075], 'collected': [3833, 3893, 4077], '318': [3851], '(a': [3852], 'rat': [3853], 'against': [3856], 'domain)': [3862], 'α7.': [3888], 'entire': [3890, 4074], 'fractions.': [3896], '°C,': [3902, 3923, 4065, 4101, 4119], 'filled': [3908, 4107], '6': [3919, 4082, 4115], 'quantitation': [3928, 4124], 'bound': [3930, 4023, 4140], 'counting.': [3934, 4129], 'Processing': [3935], 'slightly': [3939], 'involved': [3941], 'because': [3942, 4085], 'low': [3945], 'incubation': [3953, 4548], 'medium.': [3954], 'concentrated': [3958], 'α-toxin': [3966, 4029], 'isolated': [3970], 'Naja': [3975], 'naja': [3976], 'siamensiswith': [3977], 'exchange': [3979], 'chromatography': [3980], '(36Karlsson': [3981], 'E.': [3982], 'Arnberg': [3983], 'Eaker': [3985], '1971;': [3990], '21:': [3991], '1-16Crossref': [3992], '(200)': [3995], 'μl': [4032], '(5–20%)': [4044], 'centrifuge': [4048], 'tubes.': [4049], '×': [4061], 'g)': [4062], 'done': [4068], 'α7EK.': [4072, 4602], '39': [4079], 'fractions': [4080], 'each,': [4084], 'drop': [4087], 'size': [4088], 'larger': [4090, 4626], 'bound125I-αBgt': [4126], 'yield': [4131, 4156], 'theoretical': [4136], '125I-αBgt,': [4141], 'value': [4145], 'from125I-αBgt-binding': [4152], 'assays.': [4153], 'calculated': [4158, 4499, 4535, 4575], 'terms': [4160], 'per': [4165], 'oocyte.': [4166], 'variations': [4169], 'studied': [4179], '(Fig.1).': [4180], 'portion': [4192], 'Ile240.': [4202], 'intended': [4205, 4335, 4358], 'pharmacological': [4209], 'oligomerization': [4212], 'behavior': [4213], 'tethered': [4222, 4408], 'second': [4229], 'contains': [4233, 4259, 4379], 'spliced': [4244], 'junction': [4251, 4279], 'terminates': [4262], 'like': [4265], 'position': [4268], 'RRR': [4271], 'motif': [4272], '205': [4274], '207': [4276], 'suggests': [4285], 'role': [4288], 'positively-charge': [4291], 'residues;': [4292], 'therefore,': [4293], 'repeated': [4301], 'C-terminal': [4304], 'interposed': [4308], 'segment': [4309], 'name': [4313], '“α7EK”': [4314], 'derived': [4316], 'DDDDKI': [4319], 'site-specific': [4329], 'EK.': [4332], 'test': [4337], 'vitro': [4348], 'enzymatic': [4349], 'variation,': [4355], 'direct': [4362], 'route': [4363], 'Thr208,': [4374], 'just': [4375], 'no': [4380], 'domain.': [4382], 'Epitopes': [4383], 'proteins': [4401, 4458], 'detected': [4404], 'Immunoblotting': [4440], 'confirmed': [4453], '(Fig.2).': [4459], 'deglycosylation': [4462, 4512, 4591], 'migrated': [4463, 4472], 'apparent': [4466, 4477, 4564, 4606, 4629], 'mass': [4467, 4531, 4565, 4576, 4607, 4630], 'kDa;': [4470], 'kDa.': [4475], 'masses': [4478], '7': [4481], 'kDa': [4482, 4489, 4494, 4569, 4579], '30': [4488], '33.5': [4493], 'compositions.': [4503], 'detection': [4505, 4583], 'predominately': [4507], 'single': [4509], 'band': [4510, 4526], 'suggested': [4513, 4592], 'post-translational': [4515], 'modifications': [4516], 'comparatively': [4518], 'uniform': [4519], 'molecules.': [4522], 'Deglycosylation': [4523, 4603], 'shifted': [4524, 4604], 'modifications.': [4537], 'Without': [4538], 'cRNA.': [4558], 'displayed': [4562], '41': [4568], 'immunoblotting,': [4571], 'compared': [4572, 4631], '26': [4578, 4611], '(Fig.': [4580], '2).': [4581], 'diffuse': [4586], 'pattern': [4587], 'bands': [4589], 'heterogeneous': [4594], 'glycosylation': [4595, 4620], 'down': [4608], 'kDa,': [4612], 'confirming': [4613], 'most': [4618], 'extensive': [4619], 'proteins.': [4624], 'shift': [4627]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W2000746761', 'counts_by_year': [{'year': 2019, 'cited_by_count': 2}, {'year': 2018, 'cited_by_count': 1}, {'year': 2017, 'cited_by_count': 1}, {'year': 2016, 'cited_by_count': 1}, {'year': 2012, 'cited_by_count': 1}], 'updated_date': '2024-12-14T05:15:56.414948', 'created_date': '2016-06-24'}