The A-superfamily of Conotoxins

Name: Work Video:
Duration: 3 min 30 s
Ameurfina D. Santos; J. Michael McIntosh; David R. Hillyard; Lourdes J. Cruz; Baldomero M. Olivera
{'id': 'https://openalex.org/W1985482733', 'doi': 'https://doi.org/10.1074/jbc.m309654200', 'title': 'The A-superfamily of Conotoxins', 'display_name': 'The A-superfamily of Conotoxins', 'publication_year': 2004, 'publication_date': '2004-04-01', 'ids': {'openalex': 'https://openalex.org/W1985482733', 'doi': 'https://doi.org/10.1074/jbc.m309654200', 'mag': '1985482733', 'pmid': 'https://pubmed.ncbi.nlm.nih.gov/14701840'}, 'language': 'en', 'primary_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m309654200', 'pdf_url': 'http://www.jbc.org/article/S0021925819755902/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'type': 'article', 'type_crossref': 'journal-article', 'indexed_in': ['crossref', 'pubmed'], 'open_access': {'is_oa': True, 'oa_status': 'hybrid', 'oa_url': 'http://www.jbc.org/article/S0021925819755902/pdf', 'any_repository_has_fulltext': False}, 'authorships': [{'author_position': 'first', 'author': {'id': 'https://openalex.org/A5111746543', 'display_name': 'Ameurfina D. Santos', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I223532165', 'display_name': 'University of Utah', 'ror': 'https://ror.org/03r0ha626', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I223532165']}, {'id': 'https://openalex.org/I87074743', 'display_name': 'University of the Philippines Diliman', 'ror': 'https://ror.org/03tbh6y23', 'country_code': 'PH', 'type': 'education', 'lineage': ['https://openalex.org/I103911934', 'https://openalex.org/I87074743']}], 'countries': ['PH', 'US'], 'is_corresponding': False, 'raw_author_name': 'Ameurfina D. Santos', 'raw_affiliation_strings': ['Department of Biology, University of Utah, Salt Lake City, Utah 84112', 'National Institute of Molecular Biology and Biotechnology, University of the Philippines, Diliman, Quezon City 1101, Philippines'], 'affiliations': [{'raw_affiliation_string': 'Department of Biology, University of Utah, Salt Lake City, Utah 84112', 'institution_ids': ['https://openalex.org/I223532165']}, {'raw_affiliation_string': 'National Institute of Molecular Biology and Biotechnology, University of the Philippines, Diliman, Quezon City 1101, Philippines', 'institution_ids': ['https://openalex.org/I87074743']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5086864255', 'display_name': 'J. Michael McIntosh', 'orcid': 'https://orcid.org/0000-0001-9939-7981'}, 'institutions': [{'id': 'https://openalex.org/I223532165', 'display_name': 'University of Utah', 'ror': 'https://ror.org/03r0ha626', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I223532165']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'J. Michael McIntosh', 'raw_affiliation_strings': ['Department of Psychiatry, University of Utah, Salt Lake City, Utah 84112.'], 'affiliations': [{'raw_affiliation_string': 'Department of Psychiatry, University of Utah, Salt Lake City, Utah 84112.', 'institution_ids': ['https://openalex.org/I223532165']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5111818808', 'display_name': 'David R. Hillyard', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I223532165', 'display_name': 'University of Utah', 'ror': 'https://ror.org/03r0ha626', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I223532165']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'David R. Hillyard', 'raw_affiliation_strings': ['Department of Pathology, University of Utah, Salt Lake City, Utah, 84112.'], 'affiliations': [{'raw_affiliation_string': 'Department of Pathology, University of Utah, Salt Lake City, Utah, 84112.', 'institution_ids': ['https://openalex.org/I223532165']}]}, {'author_position': 'middle', 'author': {'id': 'https://openalex.org/A5110021893', 'display_name': 'Lourdes J. Cruz', 'orcid': None}, 'institutions': [{'id': 'https://openalex.org/I87074743', 'display_name': 'University of the Philippines Diliman', 'ror': 'https://ror.org/03tbh6y23', 'country_code': 'PH', 'type': 'education', 'lineage': ['https://openalex.org/I103911934', 'https://openalex.org/I87074743']}, {'id': 'https://openalex.org/I223532165', 'display_name': 'University of Utah', 'ror': 'https://ror.org/03r0ha626', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I223532165']}], 'countries': ['PH', 'US'], 'is_corresponding': False, 'raw_author_name': 'Lourdes J. Cruz', 'raw_affiliation_strings': ['Department of Biology, University of Utah, Salt Lake City, Utah 84112', 'Marine Science Institute, University of the Philippines, Diliman, Quezon City 1101, Philippines'], 'affiliations': [{'raw_affiliation_string': 'Marine Science Institute, University of the Philippines, Diliman, Quezon City 1101, Philippines', 'institution_ids': ['https://openalex.org/I87074743']}, {'raw_affiliation_string': 'Department of Biology, University of Utah, Salt Lake City, Utah 84112', 'institution_ids': ['https://openalex.org/I223532165']}]}, {'author_position': 'last', 'author': {'id': 'https://openalex.org/A5002311801', 'display_name': 'Baldomero M. Olivera', 'orcid': 'https://orcid.org/0000-0003-4556-1410'}, 'institutions': [{'id': 'https://openalex.org/I223532165', 'display_name': 'University of Utah', 'ror': 'https://ror.org/03r0ha626', 'country_code': 'US', 'type': 'education', 'lineage': ['https://openalex.org/I223532165']}], 'countries': ['US'], 'is_corresponding': False, 'raw_author_name': 'Baldomero M. Olivera', 'raw_affiliation_strings': ['Department of Biology, University of Utah Salt Lake City, Utah, 84112.'], 'affiliations': [{'raw_affiliation_string': 'Department of Biology, University of Utah Salt Lake City, Utah, 84112.', 'institution_ids': ['https://openalex.org/I223532165']}]}], 'institution_assertions': [], 'countries_distinct_count': 2, 'institutions_distinct_count': 2, 'corresponding_author_ids': [], 'corresponding_institution_ids': [], 'apc_list': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'apc_paid': {'value': 2500, 'currency': 'USD', 'value_usd': 2500, 'provenance': 'doaj'}, 'fwci': 3.089, 'has_fulltext': True, 'fulltext_origin': 'ngrams', 'cited_by_count': 129, 'citation_normalized_percentile': {'value': 0.999979, 'is_in_top_1_percent': True, 'is_in_top_10_percent': True}, 'cited_by_percentile_year': {'min': 97, 'max': 98}, 'biblio': {'volume': '279', 'issue': '17', 'first_page': '17596', 'last_page': '17606'}, 'is_retracted': False, 'is_paratext': False, 'primary_topic': {'id': 'https://openalex.org/T11818', 'display_name': 'Nicotinic Acetylcholine Receptors Study', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, 'topics': [{'id': 'https://openalex.org/T11818', 'display_name': 'Nicotinic Acetylcholine Receptors Study', 'score': 1.0, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T11178', 'display_name': 'Receptor Mechanisms and Signaling', 'score': 0.9981, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}, {'id': 'https://openalex.org/T10493', 'display_name': 'Ion channel regulation and function', 'score': 0.9966, 'subfield': {'id': 'https://openalex.org/subfields/1312', 'display_name': 'Molecular Biology'}, 'field': {'id': 'https://openalex.org/fields/13', 'display_name': 'Biochemistry, Genetics and Molecular Biology'}, 'domain': {'id': 'https://openalex.org/domains/1', 'display_name': 'Life Sciences'}}], 'keywords': [{'id': 'https://openalex.org/keywords/conotoxin', 'display_name': 'Conotoxin', 'score': 0.95156395}, {'id': 'https://openalex.org/keywords/conus', 'display_name': 'Conus', 'score': 0.8918832}], 'concepts': [{'id': 'https://openalex.org/C175234850', 'wikidata': 'https://www.wikidata.org/wiki/Q417238', 'display_name': 'Conotoxin', 'level': 3, 'score': 0.95156395}, {'id': 'https://openalex.org/C2777734688', 'wikidata': 'https://www.wikidata.org/wiki/Q1247092', 'display_name': 'Conus', 'level': 2, 'score': 0.8918832}, {'id': 'https://openalex.org/C86803240', 'wikidata': 'https://www.wikidata.org/wiki/Q420', 'display_name': 'Biology', 'level': 0, 'score': 0.672355}, {'id': 'https://openalex.org/C92028520', 'wikidata': 'https://www.wikidata.org/wiki/Q7395025', 'display_name': 'SUPERFAMILY', 'level': 3, 'score': 0.55857134}, {'id': 'https://openalex.org/C2779448229', 'wikidata': 'https://www.wikidata.org/wiki/Q3386847', 'display_name': 'Venom', 'level': 2, 'score': 0.5154565}, {'id': 'https://openalex.org/C104317684', 'wikidata': 'https://www.wikidata.org/wiki/Q7187', 'display_name': 'Gene', 'level': 2, 'score': 0.4403802}, {'id': 'https://openalex.org/C187882448', 'wikidata': 'https://www.wikidata.org/wiki/Q283478', 'display_name': 'Complementary DNA', 'level': 3, 'score': 0.4382583}, {'id': 'https://openalex.org/C167625842', 'wikidata': 'https://www.wikidata.org/wiki/Q899763', 'display_name': 'Peptide sequence', 'level': 3, 'score': 0.42228732}, {'id': 'https://openalex.org/C54355233', 'wikidata': 'https://www.wikidata.org/wiki/Q7162', 'display_name': 'Genetics', 'level': 1, 'score': 0.40657777}, {'id': 'https://openalex.org/C55493867', 'wikidata': 'https://www.wikidata.org/wiki/Q7094', 'display_name': 'Biochemistry', 'level': 1, 'score': 0.2748586}, {'id': 'https://openalex.org/C105702510', 'wikidata': 'https://www.wikidata.org/wiki/Q514', 'display_name': 'Anatomy', 'level': 1, 'score': 0.06978127}], 'mesh': [{'descriptor_ui': 'D020916', 'descriptor_name': 'Conotoxins', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': True}, {'descriptor_ui': 'D020916', 'descriptor_name': 'Conotoxins', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': True}, {'descriptor_ui': 'D000595', 'descriptor_name': 'Amino Acid Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D000818', 'descriptor_name': 'Animals', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D001483', 'descriptor_name': 'Base Sequence', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D002918', 'descriptor_name': 'Chymotrypsin', 'qualifier_ui': 'Q000494', 'qualifier_name': 'pharmacology', 'is_major_topic': False}, {'descriptor_ui': 'D002918', 'descriptor_name': 'Chymotrypsin', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D003001', 'descriptor_name': 'Cloning, Molecular', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D003062', 'descriptor_name': 'Codon', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D020916', 'descriptor_name': 'Conotoxins', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D003553', 'descriptor_name': 'Cystine', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D003553', 'descriptor_name': 'Cystine', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004252', 'descriptor_name': 'DNA Mutational Analysis', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D018076', 'descriptor_name': 'DNA, Complementary', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D018076', 'descriptor_name': 'DNA, Complementary', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D004220', 'descriptor_name': 'Disulfides', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D005822', 'descriptor_name': 'Genetic Vectors', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D008969', 'descriptor_name': 'Molecular Sequence Data', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D005810', 'descriptor_name': 'Multigene Family', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': 'Q000737', 'qualifier_name': 'chemistry', 'is_major_topic': False}, {'descriptor_ui': 'D010455', 'descriptor_name': 'Peptides', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D010957', 'descriptor_name': 'Plasmids', 'qualifier_ui': 'Q000378', 'qualifier_name': 'metabolism', 'is_major_topic': False}, {'descriptor_ui': 'D010957', 'descriptor_name': 'Plasmids', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011110', 'descriptor_name': 'Polymorphism, Genetic', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011487', 'descriptor_name': 'Protein Conformation', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D011499', 'descriptor_name': 'Protein Processing, Post-Translational', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D017434', 'descriptor_name': 'Protein Structure, Tertiary', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D017422', 'descriptor_name': 'Sequence Analysis, DNA', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D017386', 'descriptor_name': 'Sequence Homology, Amino Acid', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D012908', 'descriptor_name': 'Snails', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}, {'descriptor_ui': 'D013997', 'descriptor_name': 'Time Factors', 'qualifier_ui': '', 'qualifier_name': None, 'is_major_topic': False}], 'locations_count': 2, 'locations': [{'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m309654200', 'pdf_url': 'http://www.jbc.org/article/S0021925819755902/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, {'is_oa': False, 'landing_page_url': 'https://pubmed.ncbi.nlm.nih.gov/14701840', 'pdf_url': None, 'source': {'id': 'https://openalex.org/S4306525036', 'display_name': 'PubMed', 'issn_l': None, 'issn': None, 'is_oa': False, 'is_in_doaj': False, 'is_core': False, 'host_organization': 'https://openalex.org/I1299303238', 'host_organization_name': 'National Institutes of Health', 'host_organization_lineage': ['https://openalex.org/I1299303238'], 'host_organization_lineage_names': ['National Institutes of Health'], 'type': 'repository'}, 'license': None, 'license_id': None, 'version': None, 'is_accepted': False, 'is_published': False}], 'best_oa_location': {'is_oa': True, 'landing_page_url': 'https://doi.org/10.1074/jbc.m309654200', 'pdf_url': 'http://www.jbc.org/article/S0021925819755902/pdf', 'source': {'id': 'https://openalex.org/S140251998', 'display_name': 'Journal of Biological Chemistry', 'issn_l': '0021-9258', 'issn': ['0021-9258', '1067-8816', '1083-351X'], 'is_oa': True, 'is_in_doaj': True, 'is_core': True, 'host_organization': 'https://openalex.org/P4310320990', 'host_organization_name': 'Elsevier BV', 'host_organization_lineage': ['https://openalex.org/P4310320990'], 'host_organization_lineage_names': ['Elsevier BV'], 'type': 'journal'}, 'license': 'cc-by', 'license_id': 'https://openalex.org/licenses/cc-by', 'version': 'publishedVersion', 'is_accepted': True, 'is_published': True}, 'sustainable_development_goals': [{'id': 'https://metadata.un.org/sdg/14', 'display_name': 'Life below water', 'score': 0.61}], 'grants': [], 'datasets': [], 'versions': [], 'referenced_works_count': 30, 'referenced_works': ['https://openalex.org/W1424687720', 'https://openalex.org/W1560891849', 'https://openalex.org/W1586989529', 'https://openalex.org/W1672036172', 'https://openalex.org/W1879427106', 'https://openalex.org/W1967382991', 'https://openalex.org/W1972934511', 'https://openalex.org/W1973367908', 'https://openalex.org/W1977421510', 'https://openalex.org/W1980376542', 'https://openalex.org/W2005057056', 'https://openalex.org/W2018344451', 'https://openalex.org/W2029825170', 'https://openalex.org/W2065850187', 'https://openalex.org/W2078879206', 'https://openalex.org/W2080281482', 'https://openalex.org/W2080770784', 'https://openalex.org/W2087968966', 'https://openalex.org/W2095721204', 'https://openalex.org/W2102150987', 'https://openalex.org/W2118095065', 'https://openalex.org/W2131626832', 'https://openalex.org/W2134571618', 'https://openalex.org/W2138270253', 'https://openalex.org/W2139437087', 'https://openalex.org/W2141830709', 'https://openalex.org/W2144269738', 'https://openalex.org/W2162000418', 'https://openalex.org/W2465529490', 'https://openalex.org/W598679059'], 'related_works': ['https://openalex.org/W4388310731', 'https://openalex.org/W3005746280', 'https://openalex.org/W2107022069', 'https://openalex.org/W2073529085', 'https://openalex.org/W2053916292', 'https://openalex.org/W2040796176', 'https://openalex.org/W2040301159', 'https://openalex.org/W2028390868', 'https://openalex.org/W1986453975', 'https://openalex.org/W1967544271'], 'abstract_inverted_index': {'The': [0, 186, 372, 410, 531, 883, 915, 937, 999, 1157, 1382, 1422, 1539, 1667, 1806, 2000, 2067, 2295, 2332, 2462, 2544, 2593, 2628, 2793, 2932, 3002, 3076, 3172, 3321, 3385, 3493, 3510, 3654, 3839, 3878, 3926, 4052, 4219, 4239, 4341, 4444, 4472], 'generation': [1, 187, 2545], 'of': [2, 30, 93, 127, 135, 146, 167, 188, 216, 279, 313, 321, 332, 353, 413, 473, 496, 534, 542, 553, 556, 568, 579, 592, 894, 900, 925, 929, 958, 1014, 1070, 1083, 1086, 1142, 1267, 1293, 1342, 1411, 1460, 1478, 1489, 1502, 1517, 1533, 1579, 1635, 1756, 1762, 1767, 1788, 1832, 1854, 1859, 1880, 1887, 1897, 1904, 1945, 2069, 2082, 2180, 2190, 2196, 2204, 2212, 2227, 2240, 2263, 2290, 2307, 2311, 2325, 2343, 2350, 2363, 2389, 2396, 2405, 2546, 2553, 2558, 2602, 2630, 2665, 2690, 2738, 2775, 2814, 2819, 2851, 2895, 2934, 2943, 2949, 2968, 2982, 2994, 3004, 3039, 3053, 3091, 3099, 3121, 3203, 3220, 3236, 3341, 3355, 3374, 3389, 3431, 3465, 3468, 3480, 3485, 3495, 3499, 3512, 3548, 3572, 3587, 3606, 3616, 3627, 3656, 3682, 3890, 3901, 3937, 3996, 4022, 4054, 4061, 4092, 4133, 4148, 4226, 4241, 4249, 4281, 4317, 4375, 4393, 4429], 'functional': [3, 189, 1078], 'novelty': [4, 190], 'in': [5, 28, 44, 73, 111, 191, 214, 230, 259, 297, 394, 424, 485, 576, 625, 886, 903, 1047, 1064, 1195, 1240, 1250, 1299, 1336, 1344, 1385, 1398, 1405, 1434, 1439, 1466, 1474, 1482, 1536, 1548, 1642, 1646, 1661, 1764, 1782, 2063, 2209, 2243, 2258, 2292, 2588, 2607, 2769, 2801, 2856, 2878, 2926, 2939, 2980, 3016, 3061, 3197, 3224, 3230, 3277, 3281, 3303, 3329, 3404, 3416, 3419, 3435, 3439, 3474, 3515, 3580, 3634, 3661, 3933, 3940, 3947, 3961, 4106, 4127, 4177, 4263, 4312, 4331, 4336, 4358, 4403, 4419, 4462], 'proteins': [6, 192], 'encoded': [7, 84, 193, 270, 601, 629, 3036, 3305, 3684, 3846, 3899, 4096, 4153], 'by': [8, 194, 602, 630, 1102, 1127, 1260, 1276, 1333, 1349, 1390, 1470, 1640, 1658, 1692, 1720, 1885, 1895, 1902, 1968, 2073, 2353, 2420, 2484, 3398, 3453, 4154, 4180], 'a': [9, 91, 195, 277, 457, 493, 543, 566, 891, 904, 908, 945, 951, 991, 1096, 1131, 1269, 1471, 1483, 1577, 1662, 1674, 1700, 1722, 1729, 1783, 1830, 2005, 2012, 2039, 2288, 2397, 2474, 2477, 2485, 2489, 2586, 2637, 2696, 2746, 2864, 2998, 3017, 3097, 3190, 3208, 3372, 3395, 3399, 3454, 3463, 3466, 3672, 3847, 3976, 3984, 4097, 4253, 4260, 4322, 4327, 4350], 'gene': [10, 39, 196, 225, 605, 632, 1035, 1055, 1413, 2418, 3596], 'superfamily': [11, 177, 197, 363, 618, 889, 918, 1036, 3630], 'is': [12, 25, 132, 198, 211, 318, 547, 563, 595, 1062, 1425, 1431, 1448, 1682, 2500, 2507, 2537, 2596, 2795, 2861, 2937, 3010, 3058, 3286, 3311, 3364, 3371, 3382, 3391, 3408, 3450, 3462, 3508, 4075, 4267, 4271, 4343, 4388, 4401, 4417, 4439, 4442, 4450, 4460], 'seldom': [13, 199], 'well': [14, 159, 200, 345], 'documented.': [15, 201], 'In': [16, 202, 614, 1450, 2840, 2963, 3020], 'this': [17, 203, 612, 2739, 3436], 'report,': [18, 204], 'we': [19, 205, 1678, 2682, 3638, 3858, 3868, 3968, 4122], 'define': [20, 174, 206, 360], 'the': [21, 31, 51, 60, 69, 74, 96, 136, 175, 207, 217, 237, 246, 255, 260, 282, 322, 361, 469, 539, 550, 554, 577, 588, 593, 597, 626, 631, 640, 897, 922, 926, 935, 956, 959, 1006, 1010, 1034, 1048, 1053, 1121, 1137, 1265, 1285, 1290, 1350, 1393, 1399, 1406, 1412, 1418, 1428, 1435, 1443, 1467, 1475, 1509, 1514, 1530, 1546, 1568, 1584, 1588, 1591, 1595, 1653, 1695, 1734, 1748, 1765, 1772, 1779, 1826, 1864, 1878, 1881, 1888, 1898, 1905, 1939, 2248, 2259, 2312, 2351, 2359, 2364, 2368, 2382, 2387, 2406, 2411, 2441, 2469, 2480, 2493, 2497, 2504, 2511, 2527, 2534, 2547, 2554, 2559, 2565, 2569, 2589, 2611, 2616, 2619, 2631, 2648, 2652, 2687, 2691, 2736, 2815, 2820, 2834, 2846, 2852, 2857, 2871, 2879, 2886, 2902, 2922, 2940, 2944, 2958, 2965, 2969, 2973, 2978, 2987, 2991, 3023, 3030, 3037, 3044, 3049, 3054, 3089, 3092, 3122, 3183, 3198, 3225, 3233, 3244, 3248, 3250, 3282, 3290, 3304, 3317, 3330, 3336, 3342, 3351, 3368, 3378, 3413, 3426, 3432, 3444, 3478, 3481, 3487, 3496, 3503, 3516, 3523, 3527, 3542, 3546, 3569, 3584, 3594, 3628, 3642, 3648, 3657, 3748, 3752, 3891, 3938, 3945, 3957, 3962, 3994, 4023, 4039, 4048, 4093, 4119, 4134, 4149, 4227, 4250, 4257, 4264, 4295, 4318], 'A-conotoxin': [22, 208, 1054, 3629], 'superfamily,': [23, 209, 1056, 3597], 'which': [24, 210, 607, 901, 1038, 1058, 1677, 2284, 2582, 2763, 3381, 3625, 3857], 'widely': [26, 212], 'expressed': [27, 213, 575, 3633, 3960, 4176], 'venoms': [29, 215, 382, 415, 578, 1016], 'predatory': [32, 218, 373], 'cone': [33, 219, 374, 459, 3650], 'snails': [34, 220, 375, 460, 1535, 3195], '(Conus),': [35, 221], 'and': [36, 46, 124, 151, 170, 179, 222, 232, 310, 337, 356, 365, 379, 389, 482, 621, 645, 651, 833, 876, 942, 1067, 1072, 1077, 1081, 1115, 1184, 1231, 1247, 1402, 1417, 1427, 1442, 1487, 1505, 1508, 1524, 1587, 1652, 1697, 1714, 1736, 1747, 1774, 1838, 1856, 1863, 1893, 1938, 1959, 2057, 2178, 2206, 2230, 2247, 2322, 2367, 2394, 2422, 2488, 2510, 2561, 2615, 2658, 2729, 2790, 2830, 2882, 2910, 2930, 2957, 2984, 2986, 3026, 3069, 3258, 3260, 3264, 3319, 3505, 3537, 3583, 3591, 3612, 3645, 3742, 3765, 3907, 3912, 3919, 3982, 4043, 4066, 4116, 4165, 4217, 4279, 4293, 4334, 4339, 4365, 4372, 4406, 4409, 4422, 4425, 4465, 4468], 'show': [37, 223, 1051, 2912], 'how': [38, 181, 224, 367], 'products': [40, 226, 1637, 1655, 1750], 'that': [41, 67, 98, 227, 253, 284, 537, 565, 596, 647, 932, 1009, 1052, 1727, 2042, 2519, 2833, 2868, 2976, 3101, 3246, 3292, 3297, 3443, 3608, 3849, 3898, 3950, 4077, 4259, 4288, 4347, 4362, 4386, 4398, 4414, 4448, 4457], 'diverge': [42, 228], 'considerably': [43, 229], 'structure': [45, 231], 'function': [47, 233], 'have': [48, 234, 608, 636, 648, 890, 1031, 2642, 3239, 3599, 3869, 4123, 4141], 'arisen': [49, 235], 'within': [50, 236, 611], 'same': [52, 238, 3595, 4296], 'superfamily.': [53, 239, 633, 936], 'A': [54, 143, 240, 329, 582, 2052, 2574, 2812, 3086, 3200], 'cDNA': [55, 241, 1084, 1098, 1394, 1500, 1540, 2398, 2403, 2577, 2617, 2667, 2684, 2741, 2751, 2970, 3028, 3095, 3191, 3216, 3617, 3881, 3973, 4055, 4351, 4381], 'clone': [56, 242, 3032, 4155, 4352], 'encoding': [57, 243, 1090, 1703, 2465, 2618, 3185, 3207, 3324, 3671, 4128], 'α-conotoxin': [58, 244, 949, 1039, 1059, 1091, 1415, 2407, 2466, 2494, 2532, 2590, 2624, 2767, 2788, 2791, 3005, 3024, 3113, 3504, 3677, 3686, 3887], 'GI,': [59, 245, 950, 2533, 2828, 2907, 3067, 3255], 'first': [61, 247, 939, 1007, 1138, 2903, 3337], 'conotoxin': [62, 248, 540, 617, 627, 888, 1029, 2417, 2444, 2950, 3000], 'characterized,': [63, 249, 638], 'provided': [64, 250], 'initial': [65, 251, 4315], 'data': [66, 252], 'identified': [68, 77, 254, 263, 1126, 1259, 3969], 'A-superfamily.': [70, 256], 'Conotoxin': [71, 257], 'precursors': [72, 153, 258, 339, 628, 3507, 3900], 'A-superfamily': [75, 261, 1490, 3841, 3939, 3946, 3958, 3970], 'were': [76, 140, 262, 326, 1017, 1093, 1125, 1258, 1274, 1297, 1497, 1542, 1574, 1638, 1656, 1751, 1861, 1875, 2732, 2743, 2761, 3187, 3266], 'from': [78, 149, 264, 335, 549, 944, 955, 1095, 1105, 1379, 1492, 1499, 1513, 1529, 1936, 2078, 2568, 2669, 2678, 2686, 2735, 2745, 2782, 2845, 2870, 3007, 3033, 3065, 3084, 3088, 3131, 3178, 3189, 3194, 3215, 3218, 3446, 3619, 3843, 3874, 3972, 3975, 3983, 4082, 4144, 4304, 4349, 4353, 4380], 'six': [79, 265, 1139, 1461, 2603, 2632, 4168], 'Conus': [80, 266, 497, 545, 559, 946, 962, 1015, 1071, 1106, 1494, 1503, 1948, 2680, 3622, 3646, 3942, 3948, 3964, 3980, 3988, 4099], 'species:': [81, 267], 'most': [82, 268, 2863], '(11/16)': [83, 269], 'α-conotoxins,': [85, 271, 2805], 'but': [86, 272, 2806, 3109], 'some': [87, 273], '(5/16)': [88, 274], 'belong': [89, 275, 933, 3592, 4027], 'to': [90, 164, 276, 350, 383, 934, 989, 1024, 1037, 1057, 1136, 1186, 1284, 1457, 1583, 1590, 1739, 1785, 1824, 2186, 2201, 2271, 2299, 2522, 2526, 2572, 2584, 2636, 2641, 2803, 2848, 2917, 2921, 2996, 3022, 3106, 3243, 3268, 3393, 3448, 3533, 3593, 3602, 3745, 3854, 3904, 3922, 3956, 4028, 4038, 4047, 4087, 4108, 4246, 4346, 4391, 4453], 'family': [92, 278], 'excitatory': [94, 280, 3530, 4286], 'peptides,': [95, 281, 420, 1021, 4152], 'κA-conotoxins': [97, 113, 283, 299, 3261, 3299, 3325, 3528, 3905, 3910], 'target': [99, 285], 'voltage-gated': [100, 286, 3534], 'ion': [101, 287, 3535], 'channels.': [102, 288], 'α-Conotoxins': [103, 289], 'are': [104, 114, 290, 300, 416, 463, 600, 1438, 1465, 2520, 2626, 2764, 2787, 2838, 2891, 2955, 2961, 3326, 3519, 3529, 3574, 3609, 3631, 3659, 3859, 3920, 3931, 4085, 4125, 4367, 4411, 4427, 4436, 4470], 'two-disulfide-bridged': [105, 291], 'nicotinic': [106, 292, 953, 3539, 3749, 3761, 4172, 4228], 'antagonists,': [107, 293, 3541], '13–19': [108, 294], 'amino': [109, 117, 295, 303, 422, 1140, 1218, 1287, 1453, 2502, 2517, 2645, 2816, 2866, 3062, 3274, 3332, 3339, 3387, 3423], 'acids': [110, 296, 423, 1141, 1288, 1454, 2518, 2646, 3340, 3424], 'length;': [112, 298], 'larger': [115, 301], '(31–36': [116, 302], 'acids)': [118, 304], 'with': [119, 305, 391, 907, 995, 1130, 1161, 1308, 1395, 1600, 1649, 1687, 1745, 1753, 1891, 1955, 2011, 2038, 2224, 2287, 2304, 2766, 2807, 2875, 3747, 4326], 'three': [120, 306, 2821, 2893, 4058], 'disulfide': [121, 307, 653, 910, 997, 2810], 'bridges.': [122, 308], 'Purification': [123, 309, 1944], 'biochemical': [125, 311, 1000], 'characterization': [126, 312], 'one': [128, 314, 1581, 3667, 4147], 'peptide,': [129, 315, 2297], 'κA-conotoxin': [130, 316, 1946, 3126, 3506, 3855, 3861, 3872, 4103, 4282, 4300, 4430], 'MIVA': [131, 317, 2197, 2205, 3873, 3908], 'reported;': [133, 319], 'five': [134, 320, 652, 1286, 1396, 1403, 4079], 'other': [137, 323, 392, 558, 1589, 2016, 2804, 2919, 2923, 3635], 'predicted': [138, 324, 1419, 2521, 2640, 2822, 3045, 3077, 3123, 3331, 3392, 3927, 4086, 4348, 4379, 4383, 4445], 'conotoxins': [139, 147, 325, 333, 594, 885, 3607, 3959], 'previously': [141, 327, 1045, 1100, 1966, 2085, 2733, 2780, 3129, 4181], 'venom-purified.': [142, 328], 'comparative': [144, 330], 'analysis': [145, 331, 3090, 3658, 4053], 'purified': [148, 334, 941, 1332, 1657, 1889, 1899, 2734, 3083, 4143, 4303], 'venom,': [150, 336], 'their': [152, 338, 377, 395, 3588], 'reveal': [154, 340], 'novel': [155, 341], 'post-translational': [156, 342, 4261], 'processing,': [157, 343], 'as': [158, 160, 344, 346, 1025, 1112, 1120, 1613, 1965, 2084, 2355, 2605, 2623, 2753, 3211, 4102, 4111, 4160, 4299], 'mutational': [161, 347], 'events': [162, 348], 'leading': [163, 349], 'polymorphism.': [165, 351], 'Patterns': [166, 352, 484], 'sequence': [168, 354, 623, 1266, 1383, 1410, 1424, 1477, 1586, 2404, 2499, 2570, 2578, 2595, 2614, 2653, 2802, 2836, 2842, 2900, 2915, 2935, 3003, 3064, 3074, 3104, 3241, 3334, 3434, 3500, 3674, 3842, 3852, 3917, 4342, 4357, 4384, 4446], 'divergence': [169, 355, 2843, 2877, 2936, 3288], 'Cys': [171, 357, 913, 917, 3051, 3513], 'codon': [172, 358, 3411], 'usage': [173, 359], 'major': [176, 362], 'branches': [178, 184, 364, 370], 'suggest': [180, 366], 'these': [182, 368, 414, 2776, 3116, 3237, 3683, 4083], 'separate': [183, 369], 'arose.': [185, 371], 'use': [376], 'biochemically': [378], 'pharmacologically': [380], 'complex': [381], 'capture': [384], 'prey,': [385], 'defend': [386], 'against': [387], 'predators,': [388], 'compete': [390], 'animals': [393], 'environment': [396], '(1Olivera': [397, 2449], 'B.M.': [398, 428, 506, 519, 660, 697, 727, 748, 786, 969, 1981, 2092, 2109, 2165, 2429, 2450, 2717, 3162, 3555, 3704, 3730, 3776, 4011, 4193], 'Annu.': [399, 2451, 3556], 'Rev.': [400, 2452, 3557], 'Ecol.': [401, 2453], 'Syst.': [402, 2454], '2002;': [403, 756, 2455, 3809, 3833], '33:': [404, 2456], '25-42Crossref': [405, 2457], 'Scopus': [406, 452, 514, 527, 668, 710, 733, 765, 793, 1325, 1370, 1927, 1996, 2102, 2171, 2437, 2458, 2725, 3168, 3563, 3719, 3738, 3791, 4017, 4208], '(185)': [407, 2459], 'Google': [408, 454, 516, 529, 670, 712, 735, 767, 795, 984, 1327, 1372, 1929, 1998, 2104, 2134, 2173, 2439, 2460, 2727, 3170, 3565, 3721, 3740, 3793, 3813, 3837, 4019, 4210], 'Scholar).': [409, 455, 490, 530, 796, 985, 1328, 1999, 2174, 2461, 3171, 3566, 3838], 'active': [411, 1012], 'components': [412], 'mostly': [417], 'small,': [418, 1018], 'disulfide-rich': [419], '10–30': [421], 'length': [425, 2981], '("conotoxins")': [426], '(2Olivera': [427], 'Rivier': [429, 775, 2148, 3145, 3727], 'J.': [430, 510, 664, 698, 742, 753, 776, 787, 812, 825, 827, 831, 855, 868, 870, 874, 971, 974, 1103, 1168, 1551, 1984, 2128, 2147, 2153, 2433, 3144, 3150, 3707, 3779, 3807, 3831, 4196], 'Clark': [431], 'C.': [432, 673, 778, 804, 808, 810, 847, 851, 853, 1506, 1518, 1520, 1522, 1525, 2673, 2694, 2711, 2747, 2783, 3008, 3034, 3093, 3221, 3640, 3665, 3806, 3844, 3875, 3879, 4035, 4044, 4064, 4069, 4112, 4114, 4117, 4135, 4138, 4150, 4305, 4354], 'Ramilo': [433, 720, 2710], 'C.A.': [434, 721], 'Corpuz': [435, 718], 'G.P.': [436, 719], 'Abogadie': [437, 779], 'F.C.': [438, 780], 'Mena': [439], 'E.E.': [440], 'Woodward': [441], 'S.R.': [442, 502, 656, 2425], 'Hillyard': [443, 507, 661, 2120, 2144, 2421, 2430, 3141], 'D.R.': [444, 508, 662, 2121, 2145, 2431, 3142], 'Cruz': [445, 503, 657, 680, 724, 783, 972, 2118, 2140, 2426, 2718, 3137, 4008], 'L.J.': [446, 504, 658, 681, 725, 784, 973, 2119, 2141, 2427, 2719, 3138, 4009], 'Science.': [447], '1990;': [448, 511, 665, 2434], '249:': [449], '257-263Crossref': [450], 'PubMed': [451, 526, 709, 732, 764, 792, 983, 1324, 1369, 1926, 1995, 2101, 2133, 2170, 2724, 3167, 3562, 3718, 3737, 3790, 3812, 3836, 4016, 4207], '(512)': [453], 'As': [456, 2772, 3228, 3402, 3863, 4310], 'group,': [458], '(genus': [461], 'Conus)': [462], 'very': [464, 938, 3059], 'successful': [465], '(>500': [466], 'species),': [467], 'arguably': [468], 'largest': [470], 'single': [471, 2865], 'genus': [472], 'marine': [474], 'invertebrates': [475], '(3Kohn': [476], 'A.J.': [477], 'Perron': [478], 'F.E.': [479], 'Life': [480], 'History': [481], 'Biogeography': [483], 'Conus.': [486, 581], 'Clarendon': [487], 'Press,': [488, 1178, 1561], 'Oxford1994Google': [489], 'During': [491], 'speciation,': [492], 'remarkable': [494], 'hypermutation': [495], 'venom': [498, 555, 947, 957, 1515, 1531, 1950, 2688, 2703, 2737, 2749, 3132, 4307], 'peptides': [499, 536, 571, 599, 931, 2945, 3531, 3573, 3902, 4140], 'occurs': [500], '(4Woodward': [501, 655, 2424], 'Olivera': [505, 659, 696, 726, 747, 785, 968, 1980, 2091, 2108, 2164, 2428, 2716, 3161, 3554, 3703, 3729, 3775, 4010, 4192], 'EMBO': [509, 663, 2432], '1:': [512, 666, 2435], '1015-1020Crossref': [513, 667, 2436], '(172)': [515, 669, 2438], 'Scholar,': [517, 671, 713, 736, 768, 2105, 2135, 3722, 3794, 3814], '5Olivera': [518], 'Mol.': [520], 'Biol.': [521, 699, 754, 975, 1985, 3708, 3780, 4197], 'Cell.': [522], '1997;': [523, 3734], '8:': [524], '2101-2109Crossref': [525], '(329)': [528], 'entire': [532], 'spectrum': [533], '50–200': [535], 'comprises': [538, 2515, 3357], 'repertoire': [541], 'particular': [544], 'species': [546, 1069, 2698, 3949, 3965, 4025, 4084, 4110, 4121], 'distinct': [548, 2759], 'peptide': [551, 994, 2182, 2366, 2798, 3047, 3079, 3209, 3848, 4100, 4220, 4251, 4266, 4287, 4320, 4325], 'complement': [552], 'any': [557, 3886, 4225], 'species.': [560, 2740], 'Thus,': [561, 3367, 3567, 4105], 'it': [562, 3057, 3363], 'estimated': [564], 'total': [567, 3373], '>50,000': [569], 'different': [570, 3180, 3521, 4059, 4169], 'can': [572], 'potentially': [573], 'be': [574, 990, 2523, 2585, 2661, 3269, 3394, 3865, 3923, 4244], 'living': [580], 'simplifying': [583], 'conceptual': [584], 'framework': [585, 919], 'for': [586, 838, 881, 1005, 1189, 1414, 1605, 1671, 1705, 1771, 1778, 1813, 1818, 1848, 1871, 1877, 2235, 2252, 2358, 2416, 2599, 3012, 3335, 3361, 3522, 3675, 4063, 4068, 4236, 4252, 4269], 'addressing': [587], 'formidable': [589], 'molecular': [590], 'complexity': [591], '50,000': [598], 'relatively': [603], 'few': [604], 'superfamilies,': [606], 'greatly': [609], 'diversified': [610], 'genus.': [613], 'general,': [615, 2841], 'each': [616, 887, 1537, 2918], 'has': [619, 1042, 1073, 1728, 2468, 2704, 3048, 3080, 3691], 'distinctive': [620], 'conserved': [622, 916], 'features': [624], 'Several': [634, 1493], 'superfamilies': [635, 1030, 2419, 2445], 'been': [637, 1032, 1044, 2705, 3082, 3692, 4142], 'including': [639, 2473], 'O-,': [641], 'T-,': [642], 'P-,': [643], 'I-,': [644], 'M-superfamilies': [646], 'between': [649, 2655, 3289, 3316, 3502], 'two': [650, 996, 1248, 1452, 2643, 2774, 2924, 3118, 3173, 3179, 3322, 3524, 3570, 3604, 3759, 4067], 'cross-links': [654], '6Walker': [672], 'Steel': [674], 'D.': [675, 683, 717, 782, 815, 822, 858, 865, 1975, 2088, 2127, 2163, 3160, 3698, 3770, 4187], 'Jacobsen': [676, 2112], 'R.B.': [677, 2113], 'Lirazan': [678, 773], 'M.B.': [679, 715], 'Hooper': [682, 716], 'Shetty': [684, 771], 'R.': [685, 800, 820, 823, 843, 863, 866, 2715], 'DelaCruz': [686, 2154, 3151], 'R.C.': [687], 'Nielsen': [688, 741], 'J.S.': [689], 'Zhou': [690], 'L.': [691, 830, 873, 3826], 'Bandyopadhyay': [692, 722], 'P.': [693, 723, 798, 841], 'Craig': [694], 'A.': [695, 967, 1365, 2123, 2157, 3154, 3800, 3820], 'Chem.': [700, 755, 976, 1986, 3709, 3781, 4198], '1999;': [701, 3559], '274:': [702], '30664-30671Abstract': [703], 'Full': [704, 706, 759, 761, 980, 1990, 1992, 3713, 3715, 3785, 3787, 4202, 4204], 'Text': [705, 707, 760, 762, 981, 1991, 1993, 3714, 3716, 3786, 3788, 4203, 4205], 'PDF': [708, 763, 982, 1994, 3717, 3789, 4206], '(125)': [711], '7Lirazan': [714], 'Biochemistry.': [728, 2166, 2720, 3163, 3733], '2000;': [729], '39:': [730, 4014], '1583-1588Crossref': [731], '(65)': [734], '8Miles': [737], 'L.A.': [738], 'Dy': [739], 'C.Y.': [740], 'Barnham': [743], 'K.J.': [744], 'Hinds': [745], 'M.G.': [746], 'Bulaj': [749], 'G.': [750, 2139, 3136], 'Norton': [751], 'R.S.': [752], '277:': [757], '43033-43040Abstract': [758], '(34)': [766], '9Jimenez': [769], 'E.C.': [770], 'R.P.': [772], 'M.': [774, 806, 828, 835, 849, 871, 878, 1317, 1919, 2111, 3796, 3798, 3824, 4003], 'Walker': [777], 'Yoshikami': [781, 1974, 2126, 2162, 3159, 3697, 3769, 4186], 'Neurochem.': [788], '2003;': [789], '85:': [790], '610-621Crossref': [791], '(88)': [794], '1G.': [797, 840], 'Corpuz,': [799, 842], 'B.': [801, 834, 844, 877], 'Jacobsen,': [802, 845], 'E.': [803, 813, 846, 856, 1315, 1917], 'Jimenez,': [805, 848], 'Watkins,': [807, 850], 'Walker,': [809, 852], 'Colledge,': [811, 854], 'Garrett,': [814, 857], 'McDougal,': [816, 859], 'W.': [817, 819, 860, 862], 'Li,': [818, 861], 'Gray,': [821, 864], 'Hillyard,': [824, 867], 'Rivier,': [826, 869], 'McIntosh,': [829, 872], 'Cruz,': [832, 875], 'Olivera,': [836, 879], 'submitted': [837, 880], 'publication.': [839, 882], 'mature': [884, 2548, 2638, 3046, 3078, 3124, 3306, 3352, 3517], 'characteristic': [892, 2470, 3050], 'arrangement': [893, 3511], 'cysteine': [895], 'residues,': [896], 'oxidative': [898], 'folding': [899], 'results': [902, 3655], 'three-dimensional': [905, 923], 'scaffold': [906], 'specific': [909], 'connectivity': [911], '("the': [912], 'framework").': [914], 'largely': [920, 3327], 'determines': [921], 'conformation': [924], 'polypeptide': [927], 'backbone': [928], 'all': [930, 2049, 3681, 3889, 4021, 4078, 4237], 'toxin': [940, 1429, 2513, 2549, 2639, 2896, 2959, 3353], 'characterized': [943, 2683, 2707, 2781, 3130, 3694, 3871], 'was': [948, 987, 1159, 1331, 1347, 1388, 1528, 1603, 1673, 1717, 1808, 1843, 1866, 1931, 1953, 2002, 2053, 2060, 2071, 2183, 2198, 2245, 2250, 2268, 2285, 2302, 2335, 2346, 2371, 2446, 2579, 3096, 3128, 3213, 3678, 4157, 4302], 'competitive': [952], 'antagonist': [954], 'geography': [960], 'cone,': [961, 2693, 3644], 'geographus': [963, 1107, 3009], '(10Gray': [964], 'W.R.': [965, 1977, 2115, 2151, 2713, 3148, 3700, 3772, 4189], 'Luque': [966], 'Barrett': [970], '1981;': [977], '256:': [978], '4734-4740Abstract': [979], 'α-GI': [986, 1003, 2613, 2657], 'shown': [988, 1384, 2606, 3229, 3403, 3438, 3660, 3743, 3932, 4311], '13-amino': [992, 2528], 'acid': [993, 1958, 2056, 2266, 2529, 2817, 2867, 3063, 3275, 3333, 3388, 4324], 'cross-links.': [998], 'studies': [1001], 'on': [1002, 2004, 2273, 2373, 2443, 2899, 3954, 4167], 'established': [1004, 2415], 'time': [1008], 'biologically': [1011], 'constituents': [1013], 'multiply': [1019], 'cross-linked': [1020], 'generically': [1022], 'referred': [1023], 'conotoxins.': [1026], 'Although': [1027, 3043], 'several': [1028, 1534, 2730], 'described,': [1033], 'GI': [1040, 1060, 1092, 1143, 1416, 2408, 2467, 2495, 2591, 2768, 3006], 'belongs': [1041, 4037, 4046], 'not': [1043, 3081, 3111, 3451, 3538, 3744, 3884, 3952, 4222], 'defined': [1046], 'literature.': [1049], 'We': [1050], 'belongs,': [1061], 'found': [1063, 3267], 'fish-hunting,': [1065], 'snail-hunting,': [1066], 'worm-hunting': [1068, 4049], 'undergone': [1074], 'both': [1075, 1345, 3610], 'structural': [1076], 'diversification.': [1079], 'Isolation': [1080, 4278], 'Sequencing': [1082, 1341, 1488, 2179, 2362], 'Clones': [1085, 1124, 2668, 3618], 'α-Conotoxin': [1087, 2401, 3689], 'GI—cDNA': [1088], 'clones': [1089, 1263, 1273, 1296, 2685, 2742, 3100, 3184, 3238, 3245, 3291, 3323, 3892, 4056, 4094], 'isolated': [1094], 'size-fractionated': [1097], 'library': [1099, 2752, 3192, 3882], 'constructed': [1101], 'Hunspurger': [1104], 'duct': [1108, 2689, 2750], 'mRNA': [1109, 1511, 1527], 'using': [1110, 1163, 1279, 1374, 1544, 1576, 1608, 1933], 'pUC13': [1111], 'cloning': [1113, 1672, 1693], 'vector': [1114, 1669, 1773, 1835], 'Escherichia': [1116], 'coli': [1117], 'strain': [1118], 'MC1061F′laclq': [1119], 'host': [1122], 'cell.': [1123], 'screening': [1128, 1278], 'them': [1129], 'mixed': [1132, 2223, 2303], 'oligonucleotide': [1133], 'probe': [1134, 1158, 1282], 'corresponding': [1135, 1283, 1456, 1582], '(5′-GCXGGRTTRCARCAYTC-3′,': [1144], 'where': [1145, 2610], 'R': [1146], '=': [1147, 1150, 1153], 'AorG,': [1148], 'Y': [1149], 'CorT,and': [1151], 'X': [1152], 'AGT': [1154], 'or': [1155, 1567, 3458, 4032, 4137], 'C).': [1156], 'end-labeled': [1160], '[γ-32P]ATP': [1162], 'T4': [1164, 1757], 'polynucleotide': [1165], 'kinase': [1166], '(11Sambrook': [1167, 1550], 'Fritsch': [1169, 1552], 'E.F.': [1170, 1553], 'Maniatis': [1171, 1554], 'T.': [1172, 1311, 1555, 1913], 'Molecular': [1173, 1556], 'Cloning.': [1174, 1557], 'Cold': [1175, 1179, 1558, 1562], 'Spring': [1176, 1180, 1559, 1563], 'Harbor': [1177, 1560], 'Harbor,': [1181, 1564], 'NY1989Google': [1182, 1565], 'Scholar)': [1183, 1373, 1566, 1930, 3741, 4211], 'hybridized': [1185], 'nitrocellulose': [1187], 'filters': [1188], '40–60': [1190], 'h': [1191], 'at': [1192, 1289, 1302, 1616, 1622, 1628, 1810, 1821, 1845, 1868, 2232, 2255, 2338, 2381, 2386, 2564, 2647, 2862, 2885, 2990, 3412, 3425, 3751], '48': [1193], '°C': [1194, 1812, 1823, 1847, 1870], '3': [1196, 1241, 4333, 4400, 4416, 4459], 'm': [1197, 1221, 1242, 2214, 2218, 2316], 'tetramethylammonium': [1198, 1206], 'chloride': [1199], '(TMAC),': [1200], '2The': [1201], 'abbreviations': [1202], 'used': [1203, 1670], 'are:': [1204], 'TMAC,': [1205], 'chloride;': [1207], 'α-,': [1208], 'α-conotoxin;': [1209], 'HFBA,': [1210], 'heptafluorobutyric': [1211, 2265], 'acid;': [1212], 'HPLC,': [1213], 'high-performance': [1214], 'liquid': [1215], 'chromatography;': [1216], 'aa,': [1217, 3359], 'acid(s).': [1219], '0.1': [1220], 'sodium': [1222], 'phosphate,': [1223], '1': [1224, 1798, 2194], 'mm': [1225, 1244, 1769, 1776, 1790, 1793, 1796, 1799, 2026, 2216, 2318], 'EDTA,': [1226], '5×': [1227], "Denhardt's,": [1228], '0.6%': [1229], 'SDS,': [1230, 1255], '100': [1232], 'μg/ml': [1233], 'salmon': [1234], 'sperm': [1235], 'DNA.': [1236], 'After': [1237], 'washing': [1238], 'twice': [1239], 'TMAC/50': [1243], 'Tris/0.2%': [1245], 'SDS': [1246], 'times': [1249], '2×': [1251], 'standard': [1252, 2562], 'saline': [1253], 'citrate/0.1%': [1254], 'positive': [1256], 'colonies': [1257], 'autoradiography.': [1261], 'Some': [1262], 'gave': [1264, 4321], 'α-GIB,': [1268, 1451], 'homologous': [1270, 3414, 3903], 'α-conotoxin.': [1271], 'α-GIB': [1272, 2659], 'eliminated': [1275], 'subtractive': [1277], 'an': [1280, 1458, 1609, 2020, 2274, 2374, 2600, 2796, 2808, 3040, 3420, 3676, 3685, 4272], 'additional': [1281, 2809, 3421], 'C': [1291, 2566, 2649, 2849], 'terminus': [1292, 2567, 2850, 2993], 'α-GI.': [1294, 1479], 'Positive': [1295], 'grown': [1298], 'LB/amp/kan': [1300], 'broth': [1301], '37': [1303, 1811], '°C,': [1304, 1618, 1624, 1630], 'harvested,': [1305], 'then': [1306, 1816], 'lysed': [1307], 'alkali': [1309], '(12Hultman': [1310, 1912], 'Stahl': [1312, 1914], 'S.': [1313, 1356, 1364, 1915, 1979, 3702, 3774, 4191], 'Homes': [1314, 1916], 'Uhlen': [1316, 1918], 'Nucleic': [1318, 1920], 'Acids': [1319, 1921], 'Res.': [1320, 1922], '1989;': [1321, 1923, 2098], '17:': [1322, 1924], '4937-4946Crossref': [1323, 1925], '(664)': [1326, 1928], 'Plasmid': [1329, 1742], 'DNA': [1330, 1725, 1743, 1758, 1763, 1833, 1941], 'equilibrium': [1334], 'centrifugation': [1335], 'CsCl': [1337], 'ethidium': [1338, 1650], 'bromide': [1339], 'gradient.': [1340], 'inserts': [1343], 'strands': [1346], 'done': [1348, 1604, 1932], 'dideoxy': [1351], 'method': [1352], '(13Sanger': [1353], 'F.': [1354, 3804], 'Nicklen': [1355], 'Coulson': [1357], 'A.R.': [1358], 'Proc.': [1359], 'Natl.': [1360], 'Acad.': [1361, 2096], 'Sci.': [1362, 2097], 'U.': [1363], '1977;': [1366], '74:': [1367], '5463-5467Crossref': [1368], '(52505)': [1371], 'Sequenase': [1375], 'version': [1376], '2.0': [1377], 'enzyme': [1378], 'US': [1380], 'Biochemicals.': [1381], 'Table': [1386, 2608, 2770, 2927, 3231, 3278, 3405, 3440, 3475, 3662, 3934, 4072, 4313, 4359], 'I': [1387, 4031], 'obtained': [1389, 1512, 3176, 3188, 3214], 'walking': [1391], 'through': [1392, 1961], 'primers': [1397, 1404], 'forward': [1400], 'direction': [1401], 'reverse': [1407], 'direction.Table': [1408], 'IcDNA': [1409], 'translation': [1420], 'product': [1421, 1781, 1840], 'signal': [1423, 1446, 1585, 2475, 2498, 2835, 2858, 3252, 3581, 4330], 'shaded,': [1426, 2956], 'region': [1430, 1437, 1593, 1690, 2482, 2506, 2514, 2536, 2557, 3284, 3354], 'underlined.': [1432, 2962, 4437], 'Nucleotides': [1433], 'untranslated': [1436], 'small': [1440], 'letters,': [1441], 'poly(A)': [1444], 'addition': [1445, 2310, 3021], '(aataaa)': [1447], 'shaded.': [1449], '(KG)': [1455], 'insertion': [1459, 2601, 2629], 'nucleotides': [1462, 2541, 2633, 3470], '(AAG': [1463], 'GGA)': [1464], 'position': [1468, 3415, 4332], 'marked': [1469], 'dash': [1472], '(—)': [1473], 'above': [1476, 2357, 3108], 'Open': [1480, 3014], 'table': [1481, 3015], 'new': [1484, 3018], 'tab': [1485, 3019], 'Cloning': [1486], 'Peptides': [1491], 'Species—The': [1495], 'cDNAs': [1496, 1573], 'prepared': [1498, 1543], 'libraries': [1501, 1541, 3974], 'striatus': [1504, 2748, 2784, 3035, 3094, 3222], 'magus,': [1507, 3641, 3666, 4115], 'poly(A)+': [1510], 'ducts': [1516, 1532], 'striatus,': [1519, 2695, 4113], 'stercusmuscarum,': [1521, 3647, 4118], 'bandanus,': [1523, 3981], 'caracteristicus;': [1526], 'case.': [1538], 'either': [1545, 4029], 'protocol': [1547], 'Sambrook': [1549], 'Promega': [1569], 'Magic': [1570], 'Miniprep': [1571], 'system.': [1572], 'amplified': [1575], 'pair': [1578], 'primers,': [1580], '3′-untranslated': [1592, 2490, 2535], 'near': [1594], 'open': [1596, 2823, 2853, 3343, 3482, 3668, 3895, 3928], 'reading': [1597, 2824, 2854, 3344, 3483, 3669, 3896, 3929], 'frame.': [1598], 'Amplification': [1599], 'Vent': [1601], 'polymerase': [1602, 1759], '30': [1606, 1814, 1963, 2236], 'cycles': [1607], 'air': [1610], 'thermocycler': [1611], 'set': [1612, 3202], 'follows:': [1614], 'denaturation': [1615], '94': [1617], '0': [1619, 1625], 's;': [1620, 1626], 'annealing': [1621], '50': [1623, 1789, 2210], 'elongation': [1627], '72': [1629], '15': [1631, 2253, 2516], 's.': [1632], 'Ten-microliter': [1633], 'aliquots': [1634], 'PCR': [1636, 1780, 1839, 1896, 1903], 'analyzed': [1639, 2744, 3893, 4026, 4095, 4124], 'electrophoresis': [1641, 1660], '1.5%': [1643, 1663], 'agarose': [1644], 'gel': [1645, 1659], 'Tris-acetate': [1647], 'buffer': [1648, 2051, 2058, 2314], 'bromide,': [1651], 'remaining': [1654], 'low': [1664], 'melting': [1665], 'gel.': [1666], 'plasmid': [1668, 1890, 1900], 'modified': [1675, 1719, 4368, 4390, 4452], 'pDH52,': [1676], 'named': [1679], 'pDH78.': [1680, 1741], 'pDH52': [1681], 'basically': [1683], 'pGEM': [1684], '3Zf+': [1685], '(Promega)': [1686], 'its': [1688], 'polylinker': [1689], 'extended': [1691], 'into': [1694, 1733], 'EcoRI': [1696], 'KpnI': [1698, 1730, 1746], 'sites': [1699, 1704, 1738], 'synthetic': [1701, 1724], 'oligomer': [1702], 'EcoRI,': [1706], 'Sacl,': [1707], 'EcoRV,': [1708], 'NotI,': [1709], 'SphI,': [1710], 'NsiI,': [1711], 'StuI,': [1712], 'BgIII,': [1713], 'KpnI.': [1715], 'This': [1716, 2702], 'further': [1718], 'adding': [1721], '23-mer': [1723], 'fragment': [1726, 4404, 4420, 4463], 'site': [1731], 'inserted': [1732], 'XbaI': [1735, 1892], 'BglII': [1737], 'generate': [1740, 2997], 'digested': [1744], 'PCR-amplified': [1749], 'treated': [1752], '2': [1754, 2225, 2323, 3347], 'units': [1755, 1858], 'per': [1760], 'milligram': [1761], 'presence': [1766, 1879], '0.5': [1768, 1775, 1801], 'dATP': [1770], 'dTTP': [1777], '10-': [1784], '20-μl': [1786], 'solution': [1787], 'NaCl,': [1791], '10': [1792, 1795, 1819], 'Tris-HCl,': [1794], 'MgCl2,': [1797], 'dithiothreitol,': [1800], 'μg/μl': [1802, 2327], 'bovine': [1803], 'serum': [1804], 'albumin.': [1805], 'mixture': [1807, 1831, 1865, 2249], 'incubated': [1809, 1867, 2231, 2251, 2336], 'min,': [1815], 'heated': [1817], 'min': [1820, 1850, 2254], '70–75': [1822], 'stop': [1825, 2486, 3400, 3410], 'reaction.': [1827], 'For': [1828, 2048, 2492, 2531], 'ligation,': [1829], 'polymerase-treated': [1834], '(0.1': [1836], 'μg)': [1837, 1842], '(0.05': [1841], 'preincubated': [1844], '45': [1846], '5': [1849, 1852, 2202, 4234], 'before': [1851, 2309, 2348], 'nmol': [1853, 2195], 'ATP': [1855], '7–20': [1857], 'ligase': [1860], 'added,': [1862, 2246], '16': [1869, 1872], 'h.': [1873], 'Transformants': [1874], 'tested': [1876, 4166, 4231], 'desired': [1882], 'recombinant': [1883], 'plasmids': [1884], 'digestion': [1886, 2313], 'BglII,': [1894], 'and/or': [1901], 'colony': [1906], 'after': [1907], 'lysis.': [1908], 'Solid': [1909], 'phase': [1910], 'sequencing': [1911, 1942, 4316], 'magnetic': [1934], 'beads': [1935], 'Dynal': [1937], 'USB': [1940], 'kit.': [1943], 'MIVA—Freeze-dried': [1947], 'magus': [1949, 3845, 3876, 4306, 4355], '(500': [1951], 'mg)': [1952], 'extracted': [1954], '0.1%': [1956, 2054, 2064], 'trifluoroacetic': [1957, 2055, 2065], 'filtered': [1960], 'Centriprep': [1962], 'microconcentrators': [1964], 'described': [1967, 2086, 2356, 2754, 3866, 4161, 4182], 'Cartier': [1969, 4006], 'et': [1970, 3998], 'al.': [1971, 3999], '(14Cartier': [1972, 3695, 3767, 4184], 'G.E.': [1973, 3696, 3768, 4007, 4185], 'Gray': [1976, 2114, 2150, 2712, 3147, 3699, 3771, 4188], 'Luo': [1978, 3701, 3773, 4190], 'McIntosh': [1982, 3705, 3731, 3777, 3801, 3827, 4194], 'J.M.': [1983, 3551, 3706, 3732, 3778, 3802, 3828, 4195], '1996;': [1987, 3710, 3782, 4199], '271:': [1988, 3711, 3783, 4200], '7522-7528Abstract': [1989, 3712, 3784, 4201], '(451)': [1997, 3720, 3792, 4209], 'extract': [2001], 'fractionated': [2003], 'semi-preparative': [2006], 'Vydac': [2007], 'C18': [2008], 'column': [2009, 2024, 2278], 'equipped': [2010], 'guard': [2013, 2040], 'module.': [2014], 'All': [2015], 'chromatographic': [2017], 'purifications': [2018], 'involved': [2019], 'analytical': [2021, 2275], 'Brownlee': [2022, 2276], 'C8': [2023, 2277], '(4.6': [2025], '×': [2027, 2281], '22': [2028], 'cm,': [2029], 'RP300': [2030, 2045], 'packing,': [2031], '7-mm': [2032], 'particle': [2033], 'size,': [2034], '300-Å': [2035], 'pore': [2036], 'size)': [2037], 'cartridge': [2041], 'also': [2043, 2580], 'had': [2044, 3850, 3894], 'packing': [2046], 'material.': [2047], 'chromatograms,': [2050], 'B': [2059], '60%': [2061], 'acetonitrile': [2062, 2291, 2308], 'acid.': [2066], 'activity': [2068, 3547, 4242, 4270], 'fractions': [2070], 'monitored': [2072], 'measuring': [2074], 'synaptically': [2075], 'evoked': [2076], 'responses': [2077], 'cutaneous': [2079], 'pectoris': [2080], 'muscle': [2081], 'frog': [2083], '(15Yoshikami': [2087], 'Bagabaldo': [2089], 'Z.': [2090], 'Ann.': [2093], 'N.': [2094, 3816], 'Y.': [2095], '560:': [2099], '230-248Crossref': [2100], '(114)': [2103], '16Shon': [2106], 'K.': [2107, 3724], 'Watkins': [2110, 4002], 'Floresca': [2116], 'C.Z.': [2117], 'Bring': [2122], 'Terlau': [2124, 2158, 3155], 'H.': [2125, 2159, 3156], 'Neurosci.': [2129, 3808, 3832], '1998;': [2130, 2167, 3164], '18:': [2131], '4473-4481Crossref': [2132], '17Craig': [2136], 'A.G.': [2137, 3134], 'Zafaralla': [2138, 3135], 'Santos': [2142, 3139, 3552], 'A.D.': [2143, 3140, 3553], 'Dykert': [2146, 3143], 'J.E.': [2149, 3146, 3728], 'Imperial': [2152, 3149], 'R.G.': [2155, 3152], 'Sporning': [2156, 3153], 'West': [2160, 3157], 'P.J.': [2161, 3158], '37:': [2168, 3165], '16019-16025Crossref': [2169, 3166], '(95)': [2172, 3169], 'Pyridylethylation,': [2175], 'Chymotrypsin': [2176], 'Digestion,': [2177], 'MIVA—The': [2181], 'pyridylethylated': [2184, 2296, 2360, 4319], 'prior': [2185, 2270], 'sequencing.': [2187], 'An': [2188, 3429], 'aliquot': [2189], 'HPLC': [2191, 2272, 2354], 'fraction': [2192], 'containing': [2193], 'concentrated': [2199, 2298], 'down': [2200], 'μl': [2203, 2211, 2226, 2262, 2306, 2324, 2342], 'taken': [2207], 'up': [2208], '0.25': [2213], 'Tris/2': [2215], 'EDTA/6': [2217], 'guanidine': [2219], 'HCl,': [2220], 'pH': [2221, 2320], '7.7,': [2222], '10%': [2228], 'β-mercaptoethanol,': [2229], 'room': [2233, 2256, 2339], 'temperature': [2234, 2257], 'min.': [2237], 'Two': [2238], 'microliters': [2239], '20%': [2241], '4-vinylpyridine': [2242], 'ethanol': [2244], 'dark.': [2260], '25': [2261, 2341, 3469], '2%': [2264, 2344], '(HFBA)': [2267], 'added': [2269, 2347], '(RP300,': [2279], '220': [2280], '4.6': [2282], 'mm),': [2283], 'eluted': [2286], 'gradient': [2289], '0.05%': [2293], 'HFBA.': [2294], '∼5': [2300], 'μl,': [2301], '2.5': [2305], '(0.25': [2315], 'Tris/10': [2317], 'CaCl2,': [2319], '7.8)': [2321], '0.05': [2326], 'chymotrypsin': [2328, 2369], '(Roche': [2329], 'Applied': [2330, 2375], 'Science).': [2331], 'reaction': [2333], 'mix': [2334], 'overnight': [2337], 'temperature,': [2340], 'HFBA': [2345], 'separation': [2349], 'fragments': [2352, 2370], 'peptide.': [2361, 3042], 'alkylated': [2365, 4394], 'performed': [2372], 'Biosystems': [2376], 'model': [2377], '477A': [2378], 'protein': [2379], 'sequencer': [2380], 'Protein/DNA': [2383], 'Core': [2384], 'Facility': [2385], 'University': [2388], 'Utah': [2390], 'Cancer': [2391], 'Center.': [2392], 'Identification': [2393], 'Analysis': [2395, 3615, 3936], 'Clone': [2399], 'Encoding': [2400], 'GI—A': [2402], 'prepropeptide': [2409, 2951], 'matched': [2410], 'canonical': [2412], 'organization': [2413], 'originally': [2414], 'coworkers': [2423], 'Scholar);': [2440], 'literature': [2442], 'recently': [2447], 'reviewed': [2448], 'messenger': [2463], 'RNA': [2464], 'four-module': [2471], 'organization,': [2472], 'sequence,': [2476, 2859], '"pro"': [2478], 'region,': [2479, 2881, 3437], 'toxin-encoding': [2481, 2888], 'followed': [2483, 3397], 'codon,': [2487], 'region.': [2491, 2889], 'cDNA,': [2496], '21': [2501, 2872], 'acids,': [2503], 'pro': [2505, 2880], '28': [2508], 'aa': [2509, 2873, 3348, 3376], 'C-terminal': [2512, 2887, 3386, 3427], 'post-translationally': [2524, 4389, 4451], 'processed': [2525], 'toxin.': [2530], 'quite': [2538], 'long:': [2539], '823': [2540], '(Fig.': [2542, 4308], '1).': [2543, 2701, 3653, 3992], 'requires': [2550], 'proteolytic': [2551], 'cleavage': [2552], 'N-terminal': [2555, 3234, 3585], 'prepro': [2556], 'precursor,': [2560, 3380], 'processing': [2563], '-CGR-': [2571], '-C-NH2.': [2573], 'closely': [2575, 2799, 3204], 'related': [2576, 2676, 2800, 3205, 3576], 'found,': [2581], 'appears': [2583], 'polymorphism': [2587], 'gene.': [2592], 'nucleotide': [2594, 3433, 3472], 'identical': [2597, 3271, 3328, 3490, 4345], 'except': [2598], 'nucleotides,': [2604], 'I,': [2609], 'relevant': [2612], 'variant': [2620], '(designated': [2621, 3909], 'here': [2622], 'GIB)': [2625], 'shown.': [2627], 'would': [2634], 'lead': [2635], 'extra': [2644], 'terminus.': [2650], 'Given': [2651], 'identity': [2654, 3105, 3242, 3501, 3579, 3918], 'them,': [2656], 'may': [2660, 4243], 'allelic': [2662, 3924], 'variants.': [2663, 3925], 'Characterization': [2664, 4280], 'Related': [2666], 'Another': [2670], 'Fish-hunting': [2671, 3621], 'Species,': [2672], 'striatus—To': [2674], 'compare': [2675, 3944], 'genes': [2677], 'another': [2679], 'species,': [2681, 3637, 3979, 3987], 'striated': [2692], 'fish-hunting': [2697, 3636, 3963, 4024], '(see': [2699, 2946, 3272, 3300, 3651, 3990, 4071, 4275], 'Fig.': [2700, 3652, 3991], 'extensively': [2706, 3693], '(18Zafaralla': [2708], 'G.C.': [2709], 'Karlstrom': [2714], '1988;': [2721], '27:': [2722], '7102-7105Crossref': [2723], '(104)': [2726], 'Scholar),': [2728, 4020], 'α-conotoxins': [2731, 2779, 2827, 3055, 3066, 3294, 3318, 3549], 'under': [2755, 4162], '"Experimental': [2756, 4163], 'Procedures."': [2757], 'Five': [2758], 'sequences': [2760, 2777, 2818, 2897, 2905, 2952, 2954, 2971, 3175, 3235, 3253, 3276, 3473, 3488, 3582, 4062, 4080], 'obtained,': [2762], 'compared': [2765], 'II.': [2771], 'expected,': [2773], 'encode': [2778, 3112, 3117, 3247, 3293, 3298, 4088], 'venom.': [2785, 3085, 3877, 4145], 'These': [2786, 3914], 'SI': [2789, 2995], 'SII.': [2792], 'latter': [2794], 'unusual': [2797], 'bond.': [2811], 'comparison': [2813], 'frames': [2825, 3897, 3930], '(for': [2826], 'SI,': [2829, 2909, 3068, 3257], 'SII)': [2831, 2911], 'reveals': [2832], 'regions': [2837, 2960], 'identical.': [2839], 'increases': [2844], 'N': [2847], 'frame;': [2855], 'there': [2860, 3285, 3310, 3407, 3461], 'differs': [2869], 'consensus': [2874], 'greater': [2876, 2914], 'considerable': [2883, 3073, 3240, 3497, 3578, 3916], 'hypervariability': [2884], 'There': [2890], 'clearly': [2892, 3600], 'groups': [2894, 2925, 3571], 'based': [2898], 'similarity:': [2901], 'four': [2904], '(α-conotoxins': [2906, 3254], 'GIB,': [2908, 3256], 'much': [2913], 'homology': [2916, 3314, 3853], 'than': [2920], 'II': [2928], '(S1.1': [2929], 'SIVA/SIVB).': [2931], 'degree': [2933], 'reflected': [2938], 'biological': [2941], 'properties': [2942], '"Discussion").Table': [2947], 'IIComparison': [2948], 'Signal': [2953], 'A,': [2964], 'shaded': [2966, 3273], 'sections': [2967], 'mark': [2972], '25-nucleotide': [2974], 'alteration': [2975], 'explains': [2977], 'difference': [2979], 'κA-SIVA': [2983, 3186, 3356], 'κA-SIVB,': [2985], '6-nucleotide': [2988], 'change': [2989], 'carboxyl': [2992], 'longer': [2999], '(SII).': [3001], 'given': [3011], 'comparison.': [3013], 'SI-': [3025], 'SII-encoding': [3027], 'clones,': [3029, 3206], 'S1.1': [3031], 'precursor': [3038, 3370, 3673], 'α-conotoxin-like': [3041, 4130], 'pattern': [3052], '(–CC–C–C–),': [3056], 'divergent': [3060], 'SII': [3070, 3259], '(which': [3071], 'share': [3072, 3915], 'homology).': [3075], 'surprise': [3087], 'class': [3098], 'exhibited': [3102], 'substantial': [3103], 'those': [3107, 3296], 'did': [3110, 3883, 4221], 'precursors;': [3114, 3888], 'instead,': [3115, 3460], 'κA-conotoxins.': [3119, 3320], 'One': [3120], 'conotoxins,': [3125], 'SIVA,': [3127, 3262, 3856], '(17Craig': [3133], 'such': [3174, 4109], 'originated': [3177], 'collection': [3181], 'samples:': [3182], 'made': [3193, 3217], 'collected': [3196, 3223], 'Philippines.': [3199], 'second': [3201, 3840], 'designated': [3210], 'κA-SIVB': [3212, 3362], 'specimens': [3219], 'Hawaiian': [3226], 'Islands.': [3227], 'II,': [3232, 3441, 4033], 'α-conotoxins:': [3249], 'seven': [3251], 'SIVB,': [3263, 3417, 3486], 'S1.1)': [3265], 'virtually': [3270], 'IIA).': [3279, 3476], 'However,': [3280, 3350, 4146], 'propeptide': [3283, 3589], 'more': [3287], 'versus': [3295, 3377], '"Discussion"),': [3301], 'and,': [3302], 'toxins': [3307, 3518], '(underlined': [3308, 4356], 'sequences),': [3309], 'essentially': [3312], 'no': [3313, 3409], 'detectable': [3315], '68': [3338], 'frame': [3345, 3484, 3670], '(only': [3346], 'substitutions).': [3349], '31': [3358], 'whereas': [3360, 4034], '42': [3365], 'aa.': [3366, 3384], 'SIVA': [3369, 3390, 3447, 3906, 4301], '69': [3375], 'SIVB': [3379, 3449], '80': [3383], 'glycine': [3396], 'codon.': [3401], 'IIA,': [3406], 'resulting': [3418], '11': [3422], 'end.': [3428], 'examination': [3430], 'indicates': [3442], 'conversion': [3445], 'explained': [3452], 'simple': [3455], 'substitution,': [3456], 'insertion,': [3457], 'deletion;': [3459], 'substitution': [3464], 'block': [3467], '(shaded': [3471], 'At': [3477], '3′-end': [3479], 'become': [3489], 'once': [3491], 'again.': [3492], 'discovery': [3494], 'extent': [3498], 'unprecedented.': [3509], 'residues': [3514, 4407, 4423, 4435, 4466], 'completely': [3520], 'groups;': [3525], 'furthermore,': [3526], 'targeted': [3532], 'channels': [3536], 'receptor': [3540, 3750, 3762, 4174, 4229], 'physiological': [3543], 'mechanism': [3544], 'underlying': [3545], '(19McIntosh': [3550], 'Biochem.': [3558], '68:': [3560], '59-88Crossref': [3561], '(276)': [3564], 'although': [3568, 4256], 'genetically': [3575], '(with': [3577], 'side': [3586], 'regions)': [3590], 'they': [3598], 'diverged': [3601], 'yield': [3603, 3885], 'families': [3605], 'structurally': [3611], 'functionally': [3613], 'distinct.': [3614], 'Other': [3620], 'Species—To': [3623, 3943], 'explore': [3624], 'members': [3626, 3971], 'highly': [3632, 4284], 'investigated': [3639, 3966], "magician's": [3643], 'fly-speck': [3649], 'IIB.': [3663, 3935], 'From': [3664], 'identified;': [3679], 'surprisingly,': [3680], 'MII': [3687, 3690], 'precursor.': [3688], '20Shon': [3723], 'Koerber': [3725], 'S.C.': [3726], '36:': [3735], '15693-15700Crossref': [3736], '(57)': [3739], 'interact': [3746], 'neuromuscular': [3753], 'junction.': [3754], 'Instead,': [3755], 'α-MII': [3756], 'potently': [3757], 'blocks': [3758], 'neuronal': [3760], 'subtypes,': [3763], 'α3β2': [3764], 'α6β3β2': [3766], '21Zoli': [3795], 'Moretti': [3797], 'Zanardi': [3799], 'Clementi': [3803], 'Gotti': [3805], '22:': [3810, 3834], '8785-8789Crossref': [3811], '22Champtiaux': [3815], 'Han': [3817], 'Z.-Y.': [3818], 'Bessis': [3819], 'Rossi': [3821], 'F.M.': [3822], 'Zoli': [3823], 'Marubio': [3825], 'Changeux': [3829], 'J.-P.': [3830], '1208-1217Crossref': [3835], 'high': [3851, 4247], 'designating': [3860], 'MIVA.': [3862], 'will': [3864], 'below,': [3867], 'directly': [3870], 'stercusmuscarum': [3880], 'SmIVA': [3911], 'SmIVB).': [3913], 'likely': [3921], 'Non-piscivorous': [3941], 'do': [3951], 'prey': [3953], 'fish': [3955], 'above,': [3967], 'molluscivorous': [3977], '(snail-hunting)': [3978], 'vermivorous': [3985], '(worm-hunting)': [3986], 'caracteristicus': [3989, 4045, 4070, 4136], 'Using': [3993], 'nomenclature': [3995], 'Espiritu': [3997], '(23Espiritu': [4000], 'D.J.D.': [4001], 'Dia-Monje': [4004], 'V.': [4005], 'Toxicon.': [4012], '2001;': [4013], '1899-1916Crossref': [4015], '(144)': [4018], 'Clades': [4030], 'bandanus': [4036, 4065, 4139, 4151], 'mollusc-hunting': [4040], 'Clade': [4041, 4050], 'VI,': [4042], 'XIV.': [4051], 'yielded': [4057], 'types': [4060], 'IIC).': [4073], 'It': [4074], 'noteworthy': [4076], 'elucidated': [4081], 'α-conotoxins;': [4089], 'however,': [4090], 'none': [4091], 'three-disulfide-cross-linked-containing': [4098], '(such': [4101], 'SIVA).': [4104], 'contrast': [4107], 'non-piscivorous': [4120], 'notable': [4126], 'only': [4129], 'sequences.': [4131], 'None': [4132], 'Bn1.3,': [4156], 'chemically': [4158], 'synthesized': [4159], 'Procedures"': [4164], 'cloned': [4170], 'rat': [4171], 'acetylcholine': [4173], 'subtypes': [4175, 4230], 'Xenopus': [4178], 'oocytes': [4179], 'methods': [4183], '(α2β2,': [4212], 'α2β4,': [4213], 'α3β4,': [4214], 'α4β2,': [4215], 'α4β4,': [4216], 'α6/α3β2β3).': [4218], 'detectably': [4223], 'affect': [4224], '(IC50': [4232], '>': [4233], 'μm': [4235], 'subtypes).': [4238], 'lack': [4240], 'due': [4245], 'specificity': [4248], 'molluscan': [4254], 'target,': [4255], 'possibility': [4258], 'modification': [4262], 'native': [4265], 'required': [4268], 'alternative': [4273], 'explanation': [4274], 'next': [4276], 'section).': [4277], 'MIVA—A': [4283], 'potent': [4285], 'elicits': [4289], 'repetitive': [4290], 'action': [4291], 'potentials': [4292], 'causes': [4294], 'spastic': [4297], 'symptomatology': [4298], '2).': [4309], 'III,': [4314], '36-amino': [4323], 'faint': [4328], 'Glu': [4329], 'blanks': [4335], 'positions': [4337, 4363], '7': [4338, 4364, 4408, 4424, 4467], '9.': [4340], 'otherwise': [4344], 'IIB),': [4360], 'indicating': [4361], '9': [4366, 4410, 4426, 4469], 'Thr': [4369], 'residues.Table': [4370], 'IIISequencing': [4371], 'mass': [4373], 'spectrometry': [4374], 'κ-A-conotoxin': [4376], 'MIVASequenceAverage': [4377], 'massPredictedObservedDifferenceDaSequence': [4378], 'cloneaThe': [4382], 'assumes': [4385, 4447], 'PGRRND': [4387, 4449], 'P-NH2APELVVTATTNCCGYNPMTICPPCMCTYSCPPKRKP-NH24041.75095.31053.6Sequence': [4392], 'peptideAOγLVV-A-TNCCGYNOMTICOOCMCTYSCOOKRKOChymotrypsin': [4395], 'fragment#1AOELVV-A-TNCCGY1769.0bEstimated': [4396], 'assuming': [4397, 4413, 4456], 'residue': [4399, 4415, 4458], 'γ-carboxyglutamate': [4402, 4418, 4461], '#1a,': [4405, 4421, 4464], 'threonines2822.31053.3#1aAO-LVV-A-TNCCGY1813.1bEstimated': [4412], 'threonines2866.01053.0#2TICOOCMCTY1479.81479.2#3SCOOKRKO1064.61064.6Sequence': [4428], 'MIVAcThe': [4431], 'putative': [4432, 4473], 'glycosylated': [4433], 'threonine': [4434], 'O': [4438], 'hydroxyproline;': [4440], 'γ': [4441], 'γcarboxyglutamateAOγLVVTATTNCCGYNOMTICOOCMCTYSCOOKRKO-NH2a': [4443], 'P-NH2b': [4454], 'Estimated': [4455], 'threoninesc': [4471], 'glycos': [4474]}, 'cited_by_api_url': 'https://api.openalex.org/works?filter=cites:W1985482733', 'counts_by_year': [{'year': 2024, 'cited_by_count': 1}, {'year': 2023, 'cited_by_count': 2}, {'year': 2022, 'cited_by_count': 7}, {'year': 2021, 'cited_by_count': 7}, {'year': 2020, 'cited_by_count': 2}, {'year': 2019, 'cited_by_count': 4}, {'year': 2018, 'cited_by_count': 2}, {'year': 2017, 'cited_by_count': 5}, {'year': 2016, 'cited_by_count': 2}, {'year': 2015, 'cited_by_count': 5}, {'year': 2014, 'cited_by_count': 13}, {'year': 2013, 'cited_by_count': 16}, {'year': 2012, 'cited_by_count': 8}], 'updated_date': '2025-01-06T07:04:51.425026', 'created_date': '2016-06-24'}
Publication Information

Basic Information

Access and Citation

AI Researcher Chatbot

Primary Location

Authors

Topics

Keywords

Related Works
